Mouse Mmp9 Recombinant monoclonal antibody, PBS Only

Mmp9 Uni-rAb® Recombinant Antibody for IHC, FC (Intra), Indirect ELISA
Cat No. 82854-5-PBS
Clone No.230069F1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, FC (Intra), Indirect ELISA

230069F1, AW743869, B/MMP9, Clg4b, matrix metallopeptidase 9

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82854-5-PBS targets Mmp9 in IHC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0452

Product name: Recombinant Mouse MMP-9 protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 20-730 aa of NM_013599

Sequence: APYQRQPTFVVFPKDLKTSNLTDTQLAEAYLYRYGYTRAAQMMGEKQSLRPALLMLQKQLSLPQTGELDSQTLKAIRTPRCGVPDVGRFQTFKGLKWDHHNITYWIQNYSEDLPRDMIDDAFARAFAVWGEVAPLTFTRVYGPEADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGAGVQGDAHFDDDELWSLGKGVVIPTYYGNSNGAPCHFPFTFEGRSYSACTTDGRNDGTPWCSTTADYDKDGKFGFCPSERLYTEHGNGEGKPCVFPFIFEGRSYSACTTKGRSDGYRWCATTANYDQDKLYGFCPTRVDATVVGGNSAGELCVFPFVFLGKQYSSCTSDGRRDGRLWCATTSNFDTDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPLYSYLEGFPLNKDDIDGIQYLYGRGSKPDPRPPATTTTEPQPTAPPTMCPTIPPTAYPTVGPTVGPTGAPSPGPTSSPSPGPTGAPSPGPTAPPTAGSSEASTESLSPADNPCNVDVFDAIAEIQGALHFFKDGWYWKFLNHRGSPLQGPFLTARTWPALPATLDSAFEDPQTKRVFFFSGRQMWVYTGKTVLGPRSLDKLGLGPEVTHVSGLLPRRLGKALLFSKGRVWRFDLKSQKVDPQSVIRVDKEFSGVPWNSHDIFQYQDKAYFCHGKFFWRVSFQNEVNKVDHEVNQVDDVGYVTYDLLQCP

Predict reactive species
Full Name matrix metallopeptidase 9
Calculated Molecular Weight81kd
Observed Molecular Weight92-100 kDa
GenBank Accession NumberNM_013599
Gene Symbol Mmp9
Gene ID (NCBI) 17395
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP41245-1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Mmp9 (matrix metallopeptidase 9), also known as Clg4b. It is expected to be located inextracellular matrix. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, tissue remodeling, and disease processes, such as arthritis or metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. Studies in rhesus monkeys suggest that MMP9 is involved in IL-8-induced mobilization hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling. The pro-MMP9 is 92 kDa, and it can be detected a processed form of 68 kDa. This protein can exist as a dimer of 180 kDa (PMID:7492685).

Loading...
||
New chat

Able

正在加载,请稍候...