MultiPro® 5CFLX Anti-Human CD31 (3F8E2)

• 

  Single Cell Sequencing experiment G66065-2-5C on Resting PBMC

  G66065-2-5C was used to stain Resting PBMC and analyzed with 10x Genomics Gene Expression Flex with Feature Barcodes and Multiplexing kit with Fix-Stain protocol.

• 

  Single Cell Sequencing experiment G66065-2-5C on PBMC treated with 4hr LPS + TI

  G66065-2-5C was used to stain PBMC under 4hr LPS + TI treatment and analyzed with 10x Genomics Gene Expression Flex with Feature Barcodes and Multiplexing kit with Fix-Stain protocol.

• 

  Single Cell Sequencing experiment G66065-2-5C on Resting PBMC

  G66065-2-5C was used to stain Resting PBMC and analyzed with 10x Genomics Gene Expression Flex with Feature Barcodes and Multiplexing kit with Stain-Fix protocol.

CD31 Monoclonal Antibody for Single Cell (Intra), Single Cell

Cat No. G66065-2-5C

Clone No.3F8E2

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

Single Cell (Intra), Single Cell

Synonyms

CD31, EndoCAM, FLJ58394, GPIIA, PECA1, PECAM 1, PECAM1, VEC marker

---

Tested Applications

• Positive Single Cell (Intra) detected in: 10x Genomics Gene Expression Flex with Feature Barcodes and Multiplexing product.
• Positive Single Cell detected in: 10x Genomics Gene Expression Flex with Feature Barcodes and Multiplexing product.

Recommended dilution

• SINGLE CELL (INTRA): <0.5ug/test
• SINGLE CELL: <0.5ug/test

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Product Information

G66065-2-5C targets CD31 in Single Cell (Intra), Single Cell applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Oligo Conjugate
• Type: Monoclonal
• Immunogen:

  CatNo: Ag19730

  Product name: Recombinant human CD31 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 428-738 aa of BC022512

  Sequence: EVRCESISGTLPISYQLLKTSKVLENSTKNSNDPAVFKDNPTEDVEYQCVADNCHSHAKMLSEVLRVKVIAPVDEVQISILSSKVVESGEDIVLQCAVNEGSGPITYKFYREKEGKPFYQMTSNATQAFWTKQKANKEQEGEYYCTAFNRANHASSVPRSKILTVRVILAPWKKGLIAVVIIGVIIALLIIAAKCYFLRKAKAKQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVGNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT

• Full Name: MultiPro® 5CFLX Anti-Human CD31 (3F8E2)
• Calculated Molecular Weight: 83 kDa
• GenBank Accession Number: BC022512
• Gene Symbol: CD31
• Gene ID (NCBI): 5175
• ENSEMBL Gene ID: ENSG00000261371
• RRID: AB_3673942
• Conjugate: 5CFLX
• Full Oligo Sequence: CGGAGATGTGTATAAGAGACAGTATAACACCTGGTATCCCATATAAGAAA
• Barcode Sequence: TATAACACCTGGTAT
• Form: Liquid
• UNIPROT ID: P16284
• Storage Buffer: PBS with 1mM EDTA and 0.09% sodium azide , pH 7.3.
• Storage Conditions: 2-8°C Stable for one year after shipment.

Background Information

Platelet endothelial cell adhesion molecule-1 (PECAM-1, CD31) is a member of the immunoglobulin gene superfamily of cell adhesion molecules. CD31 is a transmembrane glycoprotein that is highly expressed on the surface of the endothelium, making up a large portion of its intracellular junctions. PECAM-1 is also present on the surface of hematopoietic cells and immune cells including platelets, monocytes, neutrophils, natural killer cells, megakaryocytes and some types of T-cell (PMID: 9011572). As well as its role in cell-cell adhesion, PECAM-1 functions as a signaling receptor, and is involved in important physiological events such as nitric oxide production, regulation of T-cell immunity and tolerance, leukocyte transendothelial migration and inflammation and angiogenesis (PMID: 21183735; 20978210; 17872453; 20634489).