MultiPro® 5CFLX Anti-Human LASP1 (1G4B6)

• 

  Single Cell Sequencing experiment G68080-1-5C on Resting PBMC

  G68080-1-5C was used to stain Resting PBMC and analyzed with 10x Genomics Gene Expression Flex with Feature Barcodes and Multiplexing kit with Fix-Stain protocol.

• 

  Single Cell Sequencing experiment G68080-1-5C on PBMC treated with 4hr LPS + TI

  G68080-1-5C was used to stain PBMC under 4hr LPS + TI treatment and analyzed with 10x Genomics Gene Expression Flex with Feature Barcodes and Multiplexing kit with Fix-Stain protocol.

LASP1 Monoclonal Antibody for Single Cell (Intra)

Cat No. G68080-1-5C

Clone No.1G4B6

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

Single Cell (Intra)

Synonyms

Lasp 1, LASP1, LIM and SH3 domain protein 1, LIM and SH3 protein 1, MLN 50, MLN50

---

Tested Applications

• Positive Single Cell (Intra) detected in: 10x Genomics Gene Expression Flex with Feature Barcodes and Multiplexing product.

Recommended dilution

• SINGLE CELL (INTRA): <0.5ug/test

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Product Information

G68080-1-5C targets LASP1 in Single Cell (Intra) applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Oligo Conjugate
• Type: Monoclonal
• Immunogen:

  CatNo: Ag18101

  Product name: Recombinant human LASP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 125-210 aa of BC012460

  Sequence: EFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAA

• Full Name: MultiPro® 5CFLX Anti-Human LASP1 (1G4B6)
• Calculated Molecular Weight: 30 kDa
• GenBank Accession Number: BC012460
• Gene Symbol: LASP1
• Gene ID (NCBI): 3927
• ENSEMBL Gene ID: ENSG00000002834
• RRID: AB_3673971
• Conjugate: 5CFLX
• Full Oligo Sequence: CGGAGATGTGTATAAGAGACAGACAATACACCAGCACCCCATATAAGAAA
• Barcode Sequence: ACAATACACCAGCAC
• Form: Liquid
• UNIPROT ID: Q14847
• Storage Buffer: PBS with 1mM EDTA and 0.09% sodium azide , pH 7.3.
• Storage Conditions: 2-8°C Stable for one year after shipment.

Background Information

LASP1(LIM and SH3 protein 1), also known as MLN50, is a 261 amino acid protein that localizes to both the cytoplasm and the cytoskeleton(PMID: 7589475). LASP1 consists of an N-terminal LIM-domain with two zinc finger motifs, followed by two central actin-binding nebulin repeats, flanked by a linker region and a C-terminal SH3 domain (PMID: 17177073, 9848085). LASP-1 interacts with F-Actin and plays an important role in the regulation of Actin-associated cytoskeletal organization. Agonist-dependent changes in LASP1 phosphorylation may regulate Actin-related ion transport activities in epithelial cells (PMID: 15465019,12571245). Overexpression of LASP-1 is associated with breast cancer, and plays a role in tumor transformation and metastasis (PMID: 17956604).