Tested Applications
| Positive Single Cell (Intra) detected in | 10x Genomics Gene Expression Flex with Feature Barcodes and Multiplexing product. |
Recommended dilution
| Application | Dilution |
|---|---|
| SINGLE CELL (INTRA) | <0.5ug/test |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Product Information
G66489-1-5C targets S100A4 in Single Cell (Intra) applications and shows reactivity with Human samples.
| Tested Reactivity | Human |
| Host / Isotype | Mouse / IgG2a |
| Class | Oligo Conjugate |
| Type | Monoclonal |
| Immunogen |
CatNo: Ag9019 Product name: Recombinant human S100A4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-101 aa of BC016300 Sequence: MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK Predict reactive species |
| Full Name | MultiPro® 5CFLX Anti-Human S100A4 (2G11B4) |
| Calculated Molecular Weight | 101 aa, 12 kDa |
| GenBank Accession Number | BC016300 |
| Gene Symbol | S100A4 |
| Gene ID (NCBI) | 6275 |
| ENSEMBL Gene ID | ENSG00000196154 |
| RRID | AB_3673955 |
| Conjugate | 5CFLX |
| Full Oligo Sequence | CGGAGATGTGTATAAGAGACAGGTACCGCGCTCGAGACCCATATAAGAAA |
| Barcode Sequence | GTACCGCGCTCGAGA |
| Form | Liquid |
| UNIPROT ID | P26447 |
| Storage Buffer | PBS with 1mM EDTA and 0.09% sodium azide , pH 7.3. |
| Storage Conditions | 2-8°C Stable for one year after shipment. |
Background Information
S100A4 is a member of the S100 family of calcium-binding proteins. The S100 family members have been involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100A4 is known to localize to and function in the nucleus, cytoplasm of cells, and the extracellular space. S100A4 has also been shown to be associated with tumor growth, motility, invasion, metastasis, angiogenesis, apoptosis, and chemoresistance. It is a fibroblast-specific protein associated with mesenchymal cell morphology and motility, is expressed during epithelial-mesenchymal transformations (EMT) in vivo (PMID: 9362334). It is a specific prognostic marker for renal survival in patients with IgAN (PMID: 16105038). It is also an improved marker for lung fibroblasts that could be useful for investigating the pathogenesis of pulmonary fibrosis(PMID: 15618458). Overexpression of S100A4 is correlated with a worse prognosis inpatients with various types of cancer.
Protocols
| MultiPro™ Cell Surface and Intracellular Staining Protocol | Download protocol |
| 10x Genomics Cell Surface Protein Only Staining Protocol | Download protocol |



