Tested Applications
| Positive WB detected in | rat liver tissue, HL-60 cells, MCF-7 cells, mouse heart tissue, mouse liver tissue, mouse skeletal muscle tissue, Ramos cells, RAW 264.7 cells |
| Positive IP detected in | mouse heart tissue |
| Positive IHC detected in | human lymphoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HEK-293 cells, HeLa cells, U-87 MG cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 9 publications below |
| WB | See 51 publications below |
| IHC | See 13 publications below |
| IF | See 4 publications below |
| IP | See 1 publications below |
Product Information
11776-1-AP targets NAMPT/PBEF in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, zebrafish samples.
| Tested Reactivity | human, mouse, rat, zebrafish |
| Cited Reactivity | human, mouse, rat, zebrafish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2434 Product name: Recombinant human NAMPT protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC020691 Sequence: MNPAAEAEFNILLATDSYKVTHYKQYPPNTSKVYSYFECREKKTENSKLRKVKYEETVFYGLQYILNKYLKGKVVTKEKIQEAKDVYKEHFQDDVFNEKGWNYILEKYDGHLPIEIKAVPEGFVIPRGNVLFTVENTDPECYWLTNWIETILVQSWYPITVATNSREQKKILAKYLLETSGNLDGLEYKLHDFGYRGVSSQETAGIGASAHLVNFKGTDTVAGLALIKKYYGTKDPVPGYSVPAAEHSTITAWGKDHEKDAFEHIVTQFSSVPVSVVSDSYDIYNACEKIWGEDLRHLIVSRSTQAPLIIRPDSGNPLDTVLKVLEILGKKFPVTENSKGYKLLPPYLRV Predict reactive species |
| Full Name | nicotinamide phosphoribosyltransferase |
| Calculated Molecular Weight | 52 kDa |
| Observed Molecular Weight | 50-55 kDa |
| GenBank Accession Number | BC020691 |
| Gene Symbol | NAMPT/PBEF |
| Gene ID (NCBI) | 10135 |
| RRID | AB_2298317 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P43490 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Nicotinamide phosphoribosyltransferase(NAMPT) has two usual synonyms termed Visfatin and PBEF. Its primary role is to catalyze the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate to yield nicotinamide mononucleotide, an intermediate in the biosynthesis of NAD, which is the rate limiting component in the mammalian NAD biosynthesis pathway. NAMPT is expressed in large amounts in bone marrow, liver tissue, and muscle tissues. NAMPT inhibits neutrophil apoptosis in experimental inflammation and clinical sepsis. NAMPT levels are altered in plasma of patients with type 2 diabetes mellitus (T2DM), and it is now evidenced that NAMPT may plays a role in lipid metabolism.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NAMPT/PBEF antibody 11776-1-AP | Download protocol |
| IHC protocol for NAMPT/PBEF antibody 11776-1-AP | Download protocol |
| IP protocol for NAMPT/PBEF antibody 11776-1-AP | Download protocol |
| WB protocol for NAMPT/PBEF antibody 11776-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cancer Cell Inhibition of De Novo NAD(+) Synthesis by Oncogenic URI Causes Liver Tumorigenesis through DNA Damage. | ||
Cell Metab NAD+ Metabolism Maintains Inducible PD-L1 Expression to Drive Tumor Immune Evasion.
| ||
Cell Death Dis Astrocyte-derived exosomal nicotinamide phosphoribosyltransferase (Nampt) ameliorates ischemic stroke injury by targeting AMPK/mTOR signaling to induce autophagy | ||
Int J Mol Sci NAD+ Anabolism Disturbance Causes Glomerular Mesangial Cell Injury in Diabetic Nephropathy. | ||
Metabolism Hyperglycemia-reduced NAD+ biosynthesis impairs corneal epithelial wound healing in diabetic mice.
| ||
Oncogenesis Inhibition of nicotinamide phosphoribosyltransferase (NAMPT) with OT-82 induces DNA damage, cell death, and suppression of tumor growth in preclinical models of Ewing sarcoma.
|
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Lenie (Verified Customer) (07-04-2025) | Included in WB (mitochondrial muscle preparation, dry blotting, used 5% milk in TBST as blocking, jad a lot of background binding) and IF (on a freeze dried sample on muscles)
![]() |
FH DAN (Verified Customer) (03-11-2022) | Very effective in getting targeted efficacy.
|
FH kishu (Verified Customer) (06-10-2021) | this Ab works well for WB (1:100) and IHC (1:200)
|
FH Iru (Verified Customer) (05-30-2019) | This antibody works really well.
|


































