• Featured Product
  • KD/KO Validated

NAMPT/PBEF Monoclonal antibody

NAMPT/PBEF Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 66385-1-Ig
Clone No.3D4D8

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Nampt, Visfatin, 3D4D8, EC:2.4.2.12, NAmPRTase

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inLNCaP cells, human heart tissue, human skeletal muscle tissue, MCF-7 cells, mouse skeletal muscle tissue, Neuro-2a cells, rat heart tissue, HeLa cells, HepG2 cells, K-562 cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells, Jurkat cells, PC-3 cells, HT-29 cells, HCT 116 cells, MOLT-4 cells
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells, HepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66385-1-Ig targets NAMPT/PBEF in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag2434

Product name: Recombinant human NAMPT protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-350 aa of BC020691

Sequence: MNPAAEAEFNILLATDSYKVTHYKQYPPNTSKVYSYFECREKKTENSKLRKVKYEETVFYGLQYILNKYLKGKVVTKEKIQEAKDVYKEHFQDDVFNEKGWNYILEKYDGHLPIEIKAVPEGFVIPRGNVLFTVENTDPECYWLTNWIETILVQSWYPITVATNSREQKKILAKYLLETSGNLDGLEYKLHDFGYRGVSSQETAGIGASAHLVNFKGTDTVAGLALIKKYYGTKDPVPGYSVPAAEHSTITAWGKDHEKDAFEHIVTQFSSVPVSVVSDSYDIYNACEKIWGEDLRHLIVSRSTQAPLIIRPDSGNPLDTVLKVLEILGKKFPVTENSKGYKLLPPYLRV

Predict reactive species
Full Name nicotinamide phosphoribosyltransferase
Calculated Molecular Weight 52 kDa
Observed Molecular Weight 52 kDa
GenBank Accession NumberBC020691
Gene Symbol NAMPT/PBEF
Gene ID (NCBI) 10135
RRIDAB_2881761
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP43490
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Nicotinamide phosphoribosyltransferase(NAMPT) has two usual synonyms termed Visfatin and PBEF. Its primary role is to catalyze the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate to yield nicotinamide mononucleotide, an intermediate in the biosynthesis of NAD, which is the rate limiting component in the mammalian NAD biosynthesis pathway. NAMPT is localized in cytoplasm and expressed in large amounts in bone marrow, liver tissue, and muscle tissues. NAMPT inhibits neutrophil apoptosis in experimental inflammation and clinical sepsis. NAMPT levels are altered in plasma of patients with type 2 diabetes mellitus (T2DM), and it is now evidenced that NAMPT may plays a role in lipid metabolism.

Protocols

Product Specific Protocols
IF protocol for NAMPT/PBEF antibody 66385-1-IgDownload protocol
IHC protocol for NAMPT/PBEF antibody 66385-1-IgDownload protocol
WB protocol for NAMPT/PBEF antibody 66385-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouse,humanWB,IF

Cell Metab

Nicotinamide metabolism face-off between macrophages and fibroblasts manipulates the microenvironment in gastric cancer

Authors - Yu Jiang
mouse,humanWB

Cell Chem Biol

NAMPT-targeting PROTAC and nicotinic acid co-administration elicit safe and robust anti-tumor efficacy in NAPRT-deficient pan-cancers

Authors - Xiaotong Zhu
mouseIF

Adv Biol (Weinh)

NAMPT/NAD+ /PARP1 Pathway Regulates CFA-Induced Inflammatory Pain via NF-κB Signaling in Rodents

Authors - Yi Dai
humanWB,IHC

J Cell Physiol

Nicotinamide phosphoribosyl transferase regulates cell growth via the Sirt1/P53 signaling pathway and is a prognosis marker in colorectal cancer.

Authors - Jing-Hua Pan
  • KD Validated
humanWB

Cell Rep

NAD+ supplement potentiates tumor-killing function by rescuing defective TUB-mediated NAMPT transcription in tumor-infiltrated T cells.

Authors - Yuetong Wang
humanWB

Cell Chem Biol

Addressing the Enzyme-independent tumor-promoting function of NAMPT via PROTAC-mediated degradation

Authors - Xiaotong Zhu
Loading...
||
New chat Able
正在加载,请稍候...