Tested Applications
| Positive IHC detected in | human liver cancer tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
Product Information
26150-1-AP targets NBCe2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, Mouse samples.
| Tested Reactivity | Human, Mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag23558 Product name: Recombinant human SLC4A5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 953-1019 aa of BC109221 Sequence: NILPEKEKKETDKKRKRKKGAHEDCDEEPQFPPPSVIKIPMESVQSDPQNGIHCIARKRSSSWSYSL Predict reactive species |
| Full Name | solute carrier family 4, sodium bicarbonate cotransporter, member 5 |
| Observed Molecular Weight | 108-127 kDa |
| GenBank Accession Number | BC109221 |
| Gene Symbol | SLC4A5 |
| Gene ID (NCBI) | 57835 |
| RRID | AB_2918099 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BY07 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NBCe2, also named as SLC4A5 and NBC4, belongs to the anion exchanger (TC 2.A.31) family. NBCe2 mediates electrogenic Na+:HCO3 − transport, and can operate in both a 1:2, and 1:3 manner, but the transport stoichiometry as well as directionality have not been defined for the renal NBCe2. The expression of NBCe2 has been reported in nearly all kidney nephron segments and CDs, indicating that some species-specificity might be present (PMID: 32547422). NBCe2 has 8 isoforms with the molecular mass of 108-127 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NBCe2 antibody 26150-1-AP | Download protocol |
| IHC protocol for NBCe2 antibody 26150-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Int J Mol Sci Cell-Type Dependent Regulation of the Electrogenic Na+/HCO3- Cotransporter 1 (NBCe1) by Hypoxia and Acidosis in Glioblastoma | ||
Neuron The sodium-bicarbonate cotransporter Slc4a5 mediates feedback at the first synapse of vision |









