NCALD Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NCALD Polyclonal antibody (12925-1-AP)

• Featured Product
• KD/KO Validated

NCALD Polyclonal Antibody for WB, IHC, ELISA

Cat No. 12925-1-AP Copied!

Publications (11)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

NCALD, neurocalcin delta, neurocalcin δ

• 

  WB analysis of mouse brain using 12925-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 12925-1-AP (NCALD antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat brain using 12925-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 12925-1-AP (NCALD Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A549 using 12925-1-AP

  WB result of NCALD antibody (12925-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-NCALD transfected A549 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse cerebellum using 12925-1-AP

  mouse cerebellum tissue were subjected to SDS PAGE followed by western blot with 12925-1-AP (NCALD antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 12925-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 12925-1-AP (NCALD antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human heart using 12925-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 12925-1-AP (NCALD antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human cerebellum using 12925-1-AP

  human cerebellum tissue were subjected to SDS PAGE followed by western blot with 12925-1-AP (NCALD antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse cerebellum using 12925-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 12925-1-AP (NCALD antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse cerebellum using 12925-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 12925-1-AP (NCALD antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 12925-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 12925-1-AP (NCALD antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 12925-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 12925-1-AP (NCALD antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 12925-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 12925-1-AP (NCALD antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 12925-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 12925-1-AP (NCALD antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for NCALD in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue, A549 cells, mouse cerebellum tissue, human brain tissue, human heart tissue, human cerebellum tissue, rat brain tissue
• Positive IHC detected in: mouse cerebellum tissue, human brain tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12925-1-AP targets NCALD in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3614

  Product name: Recombinant human NCALD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-193 aa of BC036098

  Sequence: MGKQNSKLRPEVMQDLLESTDFTEHEIQEWYKGFLRDCPSGHLSMEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISKAEMLEIVQAIYKMVSSVMKMPEDESTPEKRTEKIFRQMDTNRDGKLSMEEFIRGAKSDPSIVRLLQCDPSSAGQF

• Full Name: neurocalcin delta
• Calculated Molecular Weight: 193 aa, 22 kDa
• Observed Molecular Weight: 18-22 kDa
• GenBank Accession Number: BC036098
• Gene Symbol: NCALD
• Gene ID (NCBI): 83988
• RRID: AB_2149410
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P61601
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NCALD belongs to the recoverin family. And it is a member of the EF-hand calcium-binding protein superfamily. NCALD may be involved in the calcium-dependent regulation of rhodopsin phosphorylation. It plays an important role in the regulation of the neuronal signal transduction process. NCALD is a likely candidate for conferring susceptibility to diabetic nephropathy.

Publications

What published studies show

Anti-NCALD (Neurocalcin Delta) antibody, catalog number 12925-1-AP, has a total of 11 citations. These appear in journals including American Journal of Human Genetics, Genes & Development, International Journal of Oncology, Breast Cancer Research, International Journal of Molecular Sciences, Oncotarget, Scientific Reports, Frontiers in Molecular Neuroscience, Frontiers in Neurology, Biomarkers in Medicine, and Translational Cancer Research. Research fields span neuroscience (spinal muscular atrophy, neurogenesis, alpha-synuclein) and oncology (colorectal, breast, lung, and ovarian cancers).

Automatically generated from the 11 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Am J Hum Genet; Neurocalcin Delta Suppression Protects against Spinal Muscular Atrophy in Humans and across Species by Restoring Impaired Endocytosis.; Authors - Markus Riessland ; KO Validated
mouse	IHC	Genes Dev; Gsx2 controls region-specific activation of neural stem cells and injury-induced neurogenesis in the adult subventricular zone.; Authors - López-Juárez Alejandro A
human	WB,IHC	Int J Oncol; N6‑methyladenosine upregulates miR‑181d‑5p in exosomes derived from cancer‑associated fibroblasts to inhibit 5‑FU sensitivity by targeting NCALD in colorectal cancer.; Authors - Shengli Pan
human	WB,IHC,IF	Breast Cancer Res; Long non-coding RNA MIDEAS-AS1 inhibits growth and metastasis of triple-negative breast cancer via transcriptionally activating NCALD; Authors - Dan Luo ; KD Validated
human,mouse	WB	Int J Mol Sci; Long-Term SMN- and Ncald-ASO Combinatorial Therapy in SMA Mice and NCALD-ASO Treatment in hiPSC-Derived Motor Neurons Show Protective Effects; Authors - Anixa Muiños-Bühl
human	WB,IHC	Oncotarget; Upregulation of long intergenic noncoding RNA 00673 promotes tumor proliferation via LSD1 interaction and repression of NCALD in non-small-cell lung cancer.; Authors - Xuefei Shi