NCALD Polyclonal antibody

• 

  WB analysis of mouse brain using 12925-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 12925-1-AP (NCALD antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat brain using 12925-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 12925-1-AP (NCALD Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 12925-1-AP

  WB result of NCALD antibody (12925-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-NCALD transfected A549 cells.

• 

  WB analysis of mouse cerebellum using 12925-1-AP

  mouse cerebellum tissue were subjected to SDS PAGE followed by western blot with 12925-1-AP (NCALD antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 12925-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 12925-1-AP (NCALD antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human heart using 12925-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 12925-1-AP (NCALD antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human cerebellum using 12925-1-AP

  human cerebellum tissue were subjected to SDS PAGE followed by western blot with 12925-1-AP (NCALD antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse cerebellum using 12925-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 12925-1-AP (NCALD antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse cerebellum using 12925-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 12925-1-AP (NCALD antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human brain using 12925-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 12925-1-AP (NCALD antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human brain using 12925-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 12925-1-AP (NCALD antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 12925-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 12925-1-AP (NCALD antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 12925-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 12925-1-AP (NCALD antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

NCALD Polyclonal Antibody for WB, IHC, ELISA

Cat No. 12925-1-AP

Publications(11)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

NCALD, neurocalcin delta, neurocalcin δ

---

Tested Applications

• Positive WB detected in: mouse brain tissue, A549 cells, mouse cerebellum tissue, human brain tissue, human heart tissue, human cerebellum tissue, rat brain tissue
• Positive IHC detected in: mouse cerebellum tissue, human brain tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 8 publications below
• IHC: See 6 publications below
• IF: See 2 publications below

Product Information

12925-1-AP targets NCALD in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3614

  Product name: Recombinant human NCALD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-193 aa of BC036098

  Sequence: MGKQNSKLRPEVMQDLLESTDFTEHEIQEWYKGFLRDCPSGHLSMEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISKAEMLEIVQAIYKMVSSVMKMPEDESTPEKRTEKIFRQMDTNRDGKLSMEEFIRGAKSDPSIVRLLQCDPSSAGQF

• Full Name: neurocalcin delta
• Calculated Molecular Weight: 193 aa, 22 kDa
• Observed Molecular Weight: 18-22 kDa
• GenBank Accession Number: BC036098
• Gene Symbol: NCALD
• Gene ID (NCBI): 83988
• RRID: AB_2149410
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P61601
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NCALD belongs to the recoverin family. And it is a member of the EF-hand calcium-binding protein superfamily. NCALD may be involved in the calcium-dependent regulation of rhodopsin phosphorylation. It plays an important role in the regulation of the neuronal signal transduction process. NCALD is a likely candidate for conferring susceptibility to diabetic nephropathy.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	Genes Dev; Gsx2 controls region-specific activation of neural stem cells and injury-induced neurogenesis in the adult subventricular zone.; Authors - López-Juárez Alejandro A
mouse	WB	Am J Hum Genet; Neurocalcin Delta Suppression Protects against Spinal Muscular Atrophy in Humans and across Species by Restoring Impaired Endocytosis.; Authors - Markus Riessland ; KO Validated
human	WB,IHC	Oncotarget; Upregulation of long intergenic noncoding RNA 00673 promotes tumor proliferation via LSD1 interaction and repression of NCALD in non-small-cell lung cancer.; Authors - Xuefei Shi
human	WB,IHC	Int J Oncol; N6‑methyladenosine upregulates miR‑181d‑5p in exosomes derived from cancer‑associated fibroblasts to inhibit 5‑FU sensitivity by targeting NCALD in colorectal cancer.; Authors - Shengli Pan
human	WB	Front Neurol; Transcriptome and Proteome Analysis in LUHMES Cells Overexpressing Alpha-Synuclein.; Authors - Matthias Höllerhage
human	IHC,WB	Biomark Med; NCALD as a potential predictive biomarker for the efficacy of platinum-based chemotherapy in ovarian cancer; Authors - Sarah M Konrad