Published Applications
| KD/KO | See 1 publications below |
| WB | See 1 publications below |
Product Information
10893-1-AP targets NDRG1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0908 Product name: Recombinant human NDRG1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-109 aa of BC006260 Sequence: MADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC Predict reactive species |
| Full Name | N-myc downstream regulated 1 |
| Calculated Molecular Weight | 43 kDa |
| GenBank Accession Number | BC006260 |
| Gene Symbol | NDRG1 |
| Gene ID (NCBI) | 10397 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q92597 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
