NEK5 Polyclonal antibody

• 

  WB analysis using 26254-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26254-1-AP (NEK5 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human thyroid cancer using 26254-1-AP

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 26254-1-AP (NEK5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

NEK5 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26254-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

NEK5, NimA related protein kinase 5

---

Tested Applications

• Positive WB detected in: MDA-MB-231 cells, mouse brain tissue, rat brain tissue
• Positive IHC detected in: human thyroid cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26254-1-AP targets NEK5 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24419

  Product name: Recombinant human NEK5 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 546-708 aa of BC063885

  Sequence: SASQDIEKDLKQMRLQNTKESKNPEQKYKAKKGVKFEINLDKCISDENILQEEEAMDIPNETLTFEDGMKFKEYECVKEHGDYTDKAFEKLHCPEAGFSTQTVAAVGNRRQWDGGAPQTLLQMMAVADITSTCPTGPDSESVLSVSRQEGKTKDPYSPVLILM

• Full Name: NIMA (never in mitosis gene a)-related kinase 5
• Calculated Molecular Weight: 708 aa, 81 kDa
• Observed Molecular Weight: 70-80 kDa
• GenBank Accession Number: BC063885
• Gene Symbol: NEK5
• Gene ID (NCBI): 341676
• RRID: AB_3085851
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6P3R8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.