NEK9 Polyclonal antibody, PBS Only

• 

  WB analysis of HeLa using 11192-1-AP (same clone as 11192-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 11192-1-AP (NEK9 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11192-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 11192-1-AP (same clone as 11192-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11192-1-AP (NEK9 antibody) at dilution of 1:4500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11192-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 11192-1-AP (same clone as 11192-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 11192-1-AP (NEK9 antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11192-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 11192-1-AP (same clone as 11192-1-PBS)

  IP result of anti-NEK9 (IP:11192-1-AP, 4ug; Detection:11192-1-AP 1:1000) with HeLa cells lysate 1880 ug. This data was developed using the same antibody clone with 11192-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lymphoma using 11192-1-AP (same clone as 11192-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 11192-1-AP (NEK9 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11192-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lymphoma using 11192-1-AP (same clone as 11192-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 11192-1-AP (NEK9 antibody) at dilution of 1:200 (under 0x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11192-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 11192-1-AP (same clone as 11192-1-PBS)

  Immunofluorescent analysis of HepG2 cells, using NEK9 antibody 11192-1-AP at 1:50 dilution and FITC-labeled donkey anti-rabbit IgG(green). Blue pseudocolor = DAPI (fluorescent DNA dye). This data was developed using the same antibody clone with 11192-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 11192-1-AP (same clone as 11192-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using NEK9 antibody (11192-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 11192-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 11192-1-AP (same clone as 11192-1-PBS)

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human NEK9 (11192-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug x. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 11192-1-PBS in a different storage buffer formulation.

NEK9 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

Cat No. 11192-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

Synonyms

---

Product Information

11192-1-PBS targets NEK9 in WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1678

  Product name: Recombinant human NEK9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 734-979 aa of BC009336

  Sequence: RSNSSGLSIGTVFQSSSPGGGGGGGGGEEEDSQQESETPDPSGGFRGTMEADRGMEGLISPTEAMGNSNGASSSCPGWLRKELENAEFIPMPDSPSPLSAAFSESEKDTLPYEELQGLKVASEAPLEHKPQVEASSPRLNPAVTCAGKGTPLTPPACACSSLQVEVERLQGLVLKCLAEQQKLQQENLQIFTQLQKLNKKLEGGQQVGMHSKGTQTAKEEMEMDPKPDLDSDSWCLLGTDSCRPSL

• Full Name: NIMA (never in mitosis gene a)- related kinase 9
• Calculated Molecular Weight: 107 kDa
• Observed Molecular Weight: 120 kDa
• GenBank Accession Number: BC009336
• Gene Symbol: NEK9
• Gene ID (NCBI): 91754
• RRID: AB_2150800
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TD19
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NEK9 is also named as KIAA1995, NEK8, NERCC and belongs to the NEK Ser/Thr protein kinase family. It is originally identified as αβ-casein kinase that associates with a putative substrate Bicd2. It is also independently identified as a Nek6- and Ran GTPase-binding protein under a different name, Nercc1(PMID:14660563). Nek9, together with the highly similar (80% identical) Nek6 and Nek7, form a signaling module that is activated during mitosis and involved in the regulation of the mitotic spindle. The endogenous Nek9 (with predicted molecular mass of 120 kDa) has an apparent molecular mass of 600 kDa, also compatible with a tetramer(PMID:21454704).