Product Information
67036-1-Ig targets NGF in ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14564 Product name: Recombinant human NGF protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 180-300 aa of BC032517 Sequence: SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA Predict reactive species |
| Full Name | nerve growth factor (beta polypeptide) |
| Calculated Molecular Weight | 241 aa, 27 kDa |
| GenBank Accession Number | BC032517 |
| Gene Symbol | NGF |
| Gene ID (NCBI) | 4803 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P01138 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
