NHEDC2 Polyclonal antibody

• 

  WB analysis of human plasma using 24065-1-AP

  human plasma were subjected to SDS PAGE followed by western blot with 24065-1-AP (NHEDC2 Antibody) at dilution of 1:600 incubated at 4 degree celsius over night.

• 

  IHC staining of human brain using 24065-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 24065-1-AP (NHEDC2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human brain using 24065-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 24065-1-AP (NHEDC2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

NHEDC2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 24065-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

NHA2, NHE10, NHEDC2, SLC9B2

---

Tested Applications

• Positive WB detected in: human plasma tissue
• Positive IHC detected in: human brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24065-1-AP targets NHEDC2 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21141

  Product name: Recombinant human NHEDC2 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-156 aa of BC047447

  Sequence: MGDEDKRITYEDSEPSTGMNYTPSMHQEAQEETVMKLKGIDANEPTEGSILLKSSEKKLQETPTEANHVQRLRQMLACPPHGLLDRVITNVTIIVLLWAVVWSITGSECLPGGNLFGIIILFYCAIIGGKLLGLIKLPTLPPLPSLLGMLLAGFLI

• Full Name: Na+/H+ exchanger domain containing 2
• Calculated Molecular Weight: 537 aa, 58 kDa
• Observed Molecular Weight: ~55 kDa
• GenBank Accession Number: BC047447
• Gene Symbol: NHEDC2
• Gene ID (NCBI): 133308
• RRID: AB_2879423
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q86UD5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NHEDC2, also named as NHA2 and SLC9B2, contributes to the organellar volume homeostasis. It is required for osteoclast differentiation and bone resorption activity. NHEDC2 has two isoforms with MW 48 kDa and 58 kDa.