NKX2-2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NKX2-2 Polyclonal antibody (13013-1-AP)

NKX2-2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 13013-1-AP Copied!

Publications (10)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, ChIP, ELISA

Synonyms

Homeobox protein NK-2 homolog B, Homeobox protein Nkx 2.2, Homeobox protein Nkx-2.2, NKX2 2, NKX2.2

• 

  WB analysis of Min6 cells using 13013-1-AP

  WB result of NKX2-2 antibody (13013-1-AP) on Min6 cells with siNKX2-2, siPAX4, siNKX6-1 by Dr. Nicholas George, Sarvetnick Lab – UNMC. (the 70 kDa band is unknown).

• 

  IHC staining of mouse brain using 13013-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 13013-1-AP (NKX2-2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 13013-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 13013-1-AP (NKX2-2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for NKX2-2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Min6 cells
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13013-1-AP targets NKX2-2 in WB, IHC, IF, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4069

  Product name: Recombinant human NKX2-2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-129 aa of BC075092

  Sequence: MSLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQGALDAVQSLPLKNPFYDSSDNPYTRWLASTEGLQYSLHGLAAGAPPQDSSSKSPEPSADESPDNDKETPGGGGDAGKKR

• Full Name: NK2 homeobox 2
• Calculated Molecular Weight: 273 aa, 30 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC075092
• Gene Symbol: NKX2-2
• Gene ID (NCBI): 4821
• RRID: AB_2877903
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95096
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The NKX2-2 Polyclonal antibody (Cat# 13013-1-AP) has 10 citations across journals including Nature Communications, Nucleic Acids Research, Developmental Cell, Cell Reports, Journal of Ethnopharmacology, Cells, Journal of Cancer, and Theriogenology. Research fields span oncology (small cell lung cancer, Ewing sarcoma, colorectal cancer), neuroscience (oligodendrocyte differentiation, myelination, neural crest development), developmental biology (pancreatic organogenesis), neurodegeneration (Alzheimer's disease, demyelination), and reproductive biology (pig germ cells).

Automatically generated from the 10 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Nat Commun; Loss of the USP22 deubiquitylase confers resistance to chemotherapy in small cell lung cancer.; Authors - Scott Best
human	WB	Nucleic Acids Res; EWS-FLI1 regulates and cooperates with core regulatory circuitry in Ewing sarcoma.; Authors - Xianping Shi
mouse	WB	Dev Cell; Nuclear import carrier Hikeshi cooperates with HSP70 to promote murine oligodendrocyte differentiation and CNS myelination; Authors - Li Li
mouse	IF	Dev Cell; Identification of signaling pathways that specify a subset of migrating enteric neural crest cells at the wavefront in mouse embryos; Authors - Bingyan Zhou
mouse	IF	Cell Rep; Spatiotemporal role of SETD2-H3K36me3 in murine pancreatic organogenesis; Authors - Ping Lu
mouse	WB,ChIP	Cell Rep; A neuronal Slit1-dependent program rescues oligodendrocyte differentiation and myelination under chronic hypoxic conditions; Authors - Wenxiu Dai