• Featured Product
  • KD/KO Validated

NLRP3 Monoclonal antibody

NLRP3 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 68102-1-Ig
Clone No.3H1A7

Host / Isotype

Mouse / IgG2a

Reactivity

human and More (3)

Applications

WB, IHC, IF, IP, CoIP, ELISA, Cell treatment

3H1A7, Angiotensin/vasopressin receptor AII/AVP-like, C1orf7, CIAS1, Cold-induced autoinflammatory syndrome 1 protein

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inTHP-1 cells, LPS treated THP-1 cells
Positive IHC detected inhuman kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

NLRP3 expression is relatively low in normal tissues(PMID: 33538177, 35676979, 25524927, 24166187)

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68102-1-Ig targets NLRP3 in WB, IHC, IF, IP, CoIP, ELISA, Cell treatment applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, chicken, zebrafish, bovine
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag26289

Product name: Recombinant human NLRP3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 937-1036 aa of NM_001079821

Sequence: MLHPDCKLQVLELDNCNLTSHCCWDLSTLLTSSQSLRKLSLGNNDLGDLGVMMFCEVLKQQSCLLQNLGLSEMYFNYETKSALETLQEEKPELTVVFEPSW

Predict reactive species
Full Name NLR family, pyrin domain containing 3
Calculated Molecular Weight 118 kDa
Observed Molecular Weight110 kDa
GenBank Accession NumberNM_001079821
Gene Symbol NLRP3
Gene ID (NCBI) 114548
RRIDAB_2923634
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ96P20
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NALP3, also named as C1orf7, CIAS1 and PYPAF1, belongs to the NLRP family. NLRP3, a key and eponymous component of the NLRP3 inflammasome, plays a crucial role in innate immunity and inflammation. NALP3 may function as an inducer of apoptosis. It interacts selectively with ASC and this complex may function as an upstream activator of NF-kappa-B signaling.NALP3 inhibits TNF-alpha induced activation and nuclear translocation of RELA/NF-KB p65. Also inhibits transcriptional activity of RELA. NALP3 activates caspase-1 in response to a number of triggers including bacterial or viral infection which leads to processing and release of IL1B and IL18. Defects in NLRP3 are the cause of familial cold autoinflammatory syndrome type 1 (FCAS1) which also known as familial cold urticaria. Defects in NLRP3 are a cause of Muckle-Wells syndrome (MWS) which is urticaria-deafness-amyloidosis syndrome. Defects in NLRP3 are the cause of chronic infantile neurologic cutaneous and articular syndrome (CINCA) which also known as neonatal onset multisystem inflammatory disease (NOMID). NLRP3 has some isoforms with the MW of 106-118 kDa and 75-83 kDa(PMID: 17164409, 34680443).

Protocols

Product Specific Protocols
WB protocol for NLRP3 antibody 68102-1-IgDownload protocol
IHC protocol for NLRP3 antibody 68102-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
WB

Phytomedicine

Artesunate ameliorates diabetic xerostomia in rats through regulating oral microbiota and metabolic profile in salivary gland based on NF-κB/NLRP3 signaling pathway

Authors - Siqin Zhang
WB

Phytomedicine

Geniposide via enema alleviates colitis by modulating intestinal flora and bile acid metabolites, inhibiting S100A8/S100A9/NF-κB, and promoting TGR5 inhibition of NLRP3 inflammasome

Authors - Bao-Xin Zheng
WB

Free Radic Biol Med

Aristolochic acid I exposure triggers ovarian dysfunction by activating NLRP3 inflammasome and affecting mitochondrial homeostasis

Authors - Ming-Xin Sun
WB

Oxid Med Cell Longev

Hydrogen Sulfide Ameliorated High Choline-Induced Cardiac Dysfunction by Inhibiting cGAS-STING-NLRP3 Inflammasome Pathway

Authors - Lu Bai
humanIF

Front Immunol

USP50 regulates NLRP3 inflammasome activation in duodenogastric reflux-induced gastric tumorigenesis

Authors - Chenye Zhao
humanWB,IP

Biochim Biophys Acta Mol Basis Dis

Ischemia-reperfusion injury induces ZBP1-dependent PANoptosis in endothelial cells

Authors - Yue Cui

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Marco (Verified Customer) (07-19-2024)

Worked fine.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: NRVCM
Loading...
||
New chat Able
正在加载,请稍候...