• Featured Product
  • KD/KO Validated

NLRP3 Monoclonal antibody, PBS Only (Capture)

NLRP3 Monoclonal Antibody for WB, IHC, IF/ICC, Cytometric bead array, Sandwich ELISA, Indirect ELISA
Cat No. 68102-1-PBS
Clone No.3H1A7

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

WB, IHC, IF/ICC, Cytometric bead array, Sandwich ELISA, Indirect ELISA

3H1A7, Angiotensin/vasopressin receptor AII/AVP-like, C1orf7, CIAS1, Cold-induced autoinflammatory syndrome 1 protein

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68102-1-PBS targets NLRP3 as part of a matched antibody pair:

MP50203-1: 68102-1-PBS capture and 68102-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag26289

Product name: Recombinant human NLRP3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 937-1036 aa of NM_001079821

Sequence: MLHPDCKLQVLELDNCNLTSHCCWDLSTLLTSSQSLRKLSLGNNDLGDLGVMMFCEVLKQQSCLLQNLGLSEMYFNYETKSALETLQEEKPELTVVFEPSW

Predict reactive species
Full Name NLR family, pyrin domain containing 3
Calculated Molecular Weight 118 kDa
Observed Molecular Weight110 kDa
GenBank Accession NumberNM_001079821
Gene Symbol NLRP3
Gene ID (NCBI) 114548
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ96P20
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

NALP3, also named as C1orf7, CIAS1 and PYPAF1, belongs to the NLRP family. NLRP3, a key and eponymous component of the NLRP3 inflammasome, plays a crucial role in innate immunity and inflammation. NALP3 may function as an inducer of apoptosis. It interacts selectively with ASC and this complex may function as an upstream activator of NF-kappa-B signaling.NALP3 inhibits TNF-alpha induced activation and nuclear translocation of RELA/NF-KB p65. Also inhibits transcriptional activity of RELA. NALP3 activates caspase-1 in response to a number of triggers including bacterial or viral infection which leads to processing and release of IL1B and IL18. Defects in NLRP3 are the cause of familial cold autoinflammatory syndrome type 1 (FCAS1) which also known as familial cold urticaria. Defects in NLRP3 are a cause of Muckle-Wells syndrome (MWS) which is urticaria-deafness-amyloidosis syndrome. Defects in NLRP3 are the cause of chronic infantile neurologic cutaneous and articular syndrome (CINCA) which also known as neonatal onset multisystem inflammatory disease (NOMID). NLRP3 has some isoforms with the MW of 106-118 kDa and 75-83 kDa(PMID: 17164409, 34680443).

Loading...
||
New chat Able
正在加载,请稍候...