Product Information
80422-3-PBS targets NLRP3 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human | 
| Host / Isotype | Rabbit / IgG | 
| Class | Recombinant | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag26289 Product name: Recombinant human NLRP3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 937-1036 aa of NM_001079821 Sequence: MLHPDCKLQVLELDNCNLTSHCCWDLSTLLTSSQSLRKLSLGNNDLGDLGVMMFCEVLKQQSCLLQNLGLSEMYFNYETKSALETLQEEKPELTVVFEPSW Predict reactive species | 
                                    
| Full Name | NLR family, pyrin domain containing 3 | 
| Calculated Molecular Weight | 118 kDa | 
| GenBank Accession Number | NM_001079821 | 
| Gene Symbol | NLRP3 | 
| Gene ID (NCBI) | 114548 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Protein A purification | 
| UNIPROT ID | Q96P20 | 
| Storage Buffer | PBS only, pH 7.3. | 
| Storage Conditions | Store at -80°C. | 

