Product Information
80422-4-PBS targets NLRP3 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag26289 Product name: Recombinant human NLRP3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 937-1036 aa of NM_001079821 Sequence: MLHPDCKLQVLELDNCNLTSHCCWDLSTLLTSSQSLRKLSLGNNDLGDLGVMMFCEVLKQQSCLLQNLGLSEMYFNYETKSALETLQEEKPELTVVFEPSW Predict reactive species |
Full Name | NLR family, pyrin domain containing 3 |
Calculated Molecular Weight | 118 kDa |
GenBank Accession Number | NM_001079821 |
Gene Symbol | NLRP3 |
Gene ID (NCBI) | 114548 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q96P20 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |