NMI Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of HeLa using 83986-2-RR (same clone as 83986-2-PBS)

  WB result of NMI antibody (83986-2-RR; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-NMI transfected HeLa cells. This data was developed using the same antibody clone with 83986-2-PBS in a different storage buffer formulation.

• 

  WB analysis using 83986-2-RR (same clone as 83986-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83986-2-RR (NMI antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83986-2-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 83986-2-RR (same clone as 83986-2-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using NMI antibody (83986-2-RR, Clone: 241135A9 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 83986-2-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 83986-2-RR (same clone as 83986-2-PBS)

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug NMI Recombinant antibody (83986-2-RR, Clone:241135A9) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83986-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83986-2-RR

  Biolayer interferometry (BLl) kinetic assays of 83986-2-RR against Human NMI were performed. The affinity constant is 1.98 nM.

• Featured Product
• KD/KO Validated

NMI Uni-rAb^® Recombinant Antibody for WB, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 83986-2-PBS

Clone No.241135A9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

241135A9, N myc (and STAT) interactor, N myc and STAT interactor, N myc interactor, N-myc and STAT interactor

---

Product Information

83986-2-PBS targets NMI in WB, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34759

  Product name: Recombinant human NMI protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-100 aa of BC001268

  Sequence: MEADKDDTQQILKEHSPDEFIKDEQNKGLIDEITKKNIQLKKEIQKLETELQEATKEFQIKEDIPETKMKFLSVETPENDSQLSNISCSFQVSSKVPYEI

• Full Name: N-myc (and STAT) interactor
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC001268
• Gene Symbol: NMI
• Gene ID (NCBI): 9111
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13287
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

N-Myc and STAT Interactor protein (NMI) is an interferon inducible protein that interacts with NMYC and CMYC (members of the oncogene Myc family), and other transcription factors containing a Zip, HLH, or HLH-Zip motif. It is widely involved in the process of tumor growth, progression, and metastasis.