NMI Recombinant monoclonal antibody, PBS Only

• 

NMI Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 83986-4-PBS

Clone No.241135E5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

N myc (and STAT) interactor, N myc and STAT interactor, N myc interactor, N-myc and STAT interactor, N-myc-interactor

---

Product Information

83986-4-PBS targets NMI in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34759

  Product name: Recombinant human NMI protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-100 aa of BC001268

  Sequence: MEADKDDTQQILKEHSPDEFIKDEQNKGLIDEITKKNIQLKKEIQKLETELQEATKEFQIKEDIPETKMKFLSVETPENDSQLSNISCSFQVSSKVPYEI

• Full Name: N-myc (and STAT) interactor
• Calculated Molecular Weight: 35 kDa
• GenBank Accession Number: BC001268
• Gene Symbol: NMI
• Gene ID (NCBI): 9111
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13287
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.