Tested Applications
Positive WB detected in | mouse skeletal muscle tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
28493-1-AP targets NMNAT1 in WB, ELISA applications and shows reactivity with Human, mouse samples.
Tested Reactivity | Human, mouse |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag29584 Product name: Recombinant human NMNAT1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 52-152 aa of BC014943 Sequence: GDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQDSSQKKSLEPKTKAVPKVK Predict reactive species |
Full Name | nicotinamide nucleotide adenylyltransferase 1 |
Calculated Molecular Weight | 33 kDa |
Observed Molecular Weight | 35 kDa |
GenBank Accession Number | BC014943 |
Gene Symbol | NMNAT1 |
Gene ID (NCBI) | 64802 |
RRID | AB_3086056 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9HAN9 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NMNAT1 is a member of the nicotinamide-nucleotide adenylyltransferases (NMNATs) which catalyze nicotinamide adenine dinucleotide (NAD) synthesis (PMID: 28445802). NMNAT is a central enzyme in NAD biosynthesis, catalyzing the formation of NAD+ from nicotinamide mononucleotide (NMN) and ATP (PMID: 17402747). NMNAT1 is widely expressed with the highest levels in skeletal muscle, heart, and kidney(PMID: 11027696). Mutations in NMNAT1 have been shown associated with the LCA9 form of the retinal degeneration pathology Leber's congenital amaurosis (PMID: 22842229, 22842230).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for NMNAT1 antibody 28493-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |