NMNAT3 Polyclonal antibody, PBS Only

• 

  WB analysis of mouse kidney using 13236-1-AP (same clone as 13236-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 13236-1-AP (NMNAT3 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13236-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse skeletal muscle using 13236-1-AP (same clone as 13236-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 13236-1-AP (NMNAT3 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13236-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse kidney using 13236-1-AP (same clone as 13236-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse kidney tissue using NMNAT3 antibody (13236-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13236-1-PBS in a different storage buffer formulation.

NMNAT3 Polyclonal Antibody for WB, IF-P, Indirect ELISA

Cat No. 13236-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF-P, Indirect ELISA

Synonyms

EC:2.7.7.1, EC:2.7.7.18, FKSG76, NaMN adenylyltransferase 3, Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 3

---

Product Information

13236-1-PBS targets NMNAT3 in WB, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3965

  Product name: Recombinant human NMNAT3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-215 aa of BC034374

  Sequence: MYQVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIRVDPWESEQAQWMETVKVLRHHHSKLLRSPPQMEGPDHGKALFSTPAAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLVCVGRVGHDPKGYIAESPILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKYLIPDAVITYIKDHGLYTKGSTWKGKSTQSTEGKTS

• Full Name: nicotinamide nucleotide adenylyltransferase 3
• Calculated Molecular Weight: 215 aa, 24 kDa
• Observed Molecular Weight: 24-28 kDa
• GenBank Accession Number: BC034374
• Gene Symbol: NMNAT3
• Gene ID (NCBI): 349565
• RRID: AB_2877927
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96T66
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.