iNOS Polyclonal antibody

• Home
• Products
• Primary Antibodies
• iNOS Polyclonal antibody (22226-1-AP)

iNOS Polyclonal Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 22226-1-AP Copied!

Publications (459)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (3)

Applications

WB, IHC, IF, FC (Intra), CoIP, ELISA, Cell treatment, qPCR, Western Blot

Synonyms

NOS2, EC:1.14.13.39, Hepatocyte NOS, HEP-NOS, Inducible NO synthase

• 

  WB analysis using 22226-1-AP

  Untreated and LPS treated RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 22226-1-AP (NOS2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 22226-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22226-1-AP (iNOS antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 22226-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 22226-1-AP (iNOS antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 22226-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 22226-1-AP (iNOS antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 22226-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 22226-1-AP (iNOS antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 22226-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 22226-1-AP (iNOS antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of RAW 264.7 using 22226-1-AP

  1X10^6 LPS treated RAW 264.7 cells were intracellularly stained with 0.4 ug Anti-Human iNOS (22226-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for iNOS in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Caco-2 cells, RAW 264.7 cells
• Positive IHC detected in: mouse liver tissue, human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive FC (Intra) detected in: LPS treated RAW 264.7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22226-1-AP targets iNOS in WB, IHC, IF, FC (Intra), CoIP, ELISA, Cell treatment, qPCR, Western Blot applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat, rabbit, chicken
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17567

  Product name: Recombinant human NOS2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-190 aa of BC130283

  Sequence: MACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHNLSKQQNESPQPLVETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIMTPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQLTGDELIFAT

• Full Name: nitric oxide synthase 2, inducible
• Calculated Molecular Weight: 1153 aa, 131 kDa
• Observed Molecular Weight: 110-130 kDa, 65-70 kDa
• GenBank Accession Number: BC130283
• Gene Symbol: iNOS
• Gene ID (NCBI): 4843
• RRID: AB_2879038
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P35228
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NOS2, also named as iNOS and NOS2A, produces nitric oxide (NO) which is a messenger molecule with diverse functions throughout the body. NO is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission, antimicrobial and antitumoral activities. NOS2 is a nitric oxide synthase which is expressed in liver and is inducible by a combination of lipopolysaccharide and certain cytokines. iNOS has a very short half-life due to rapid degradation by calpain. iNOS monomer is a direct substrate of calpain I and can be cleaved by calpain I at the canonical CaM-binding site(503-532aa) of iNOS, and then a ~70kD band can be detected by western (PMID:11786228).

Publications

What published studies show

The iNOS Polyclonal antibody (Cat# 22226-1-AP) has 459 total citations. Publications appear in high-impact journals including Nature Communications, Advanced Materials, Bioactive Materials, ACS Nano, Theranostics, Biomaterials, Advanced Science, Journal of Nanobiotechnology, Redox Biology, Journal of Neuroinflammation, Phytomedicine, and Brain, Behavior, and Immunity. Key research fields encompass neuroinflammation, macrophage polarization, diabetic wound healing, bone regeneration, spinal cord injury, atherosclerosis, rheumatoid arthritis, osteoarthritis, liver fibrosis, cancer immunology, sepsis, myocardial infarction, and neurodegenerative diseases.

Automatically generated from the 459 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IF	Signal Transduct Target Ther; Nature-inspired confined cascade enzyme nanoreactors for targeted atherosclerosis therapy.; Authors - Yuehuang Wu
human	WB	Exploration (Beijing); Targeting eEF1A1 With Baicalein to Block eEF1A1/Prdx4 Interaction for Treating Sepsis-Mediated Lung Injury; Authors - Jing Chang
mouse	IF	Adv Mater; Photothermal and Photocatalytic Glycol Chitosan and Polydopamine-Grafted Oxygen Vacancy Bismuth Oxyiodide (BiO1-x I) Nanoparticles for the Diagnosis and Targeted Therapy of Diabetic Wounds; Authors - Jianglong Kong
mouse	IF	Adv Mater; LPS-Binding Hydrogel for TLR4-Mediated Microbiota-Immune Modulation.; Authors - Jiali Chen
mouse	IHC	Bioact Mater; Immunomodulatory effects of biodegradable Mg-Cu-Zn alloy in esophageal cancer.; Authors - Lu Chen
	WB	Bioact Mater; A tantalum-containing zirconium-based metallic glass with superior endosseous implant relevant properties; Authors - Yunshu Wu