iNOS Polyclonal antibody

• 

  WB analysis using 22226-1-AP

  Untreated and LPS treated RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 22226-1-AP (NOS2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  FC experiment of RAW 264.7 using 22226-1-AP

  1X10^6 LPS treated RAW 264.7 cells were intracellularly stained with 0.4 ug Anti-Human iNOS (22226-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

iNOS Polyclonal Antibody for WB, FC (Intra), ELISA

Cat No. 22226-1-AP

Publications(199)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (2)

Applications

WB, IHC, IF, FC (Intra), ELISA, Cell treatment

Synonyms

NOS2, EC:1.14.13.39, Hepatocyte NOS, HEP-NOS, Inducible NO synthase

---

Tested Applications

• Positive WB detected in: RAW 264.7 cells
• Positive FC (Intra) detected in: LPS treated RAW 264.7 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 137 publications below
• IHC: See 28 publications below
• IF: See 74 publications below

Product Information

22226-1-AP targets iNOS in WB, IHC, IF, FC (Intra), ELISA, Cell treatment applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat, chicken
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17567

  Product name: Recombinant human NOS2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-190 aa of BC130283

  Sequence: MACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHNLSKQQNESPQPLVETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIMTPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQLTGDELIFAT

• Full Name: nitric oxide synthase 2, inducible
• Calculated Molecular Weight: 1153 aa, 131 kDa
• Observed Molecular Weight: 110-130 kDa, 65-70 kDa
• GenBank Accession Number: BC130283
• Gene Symbol: iNOS
• Gene ID (NCBI): 4843
• RRID: AB_2879038
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P35228
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NOS2, also named as iNOS and NOS2A, produces nitric oxide (NO) which is a messenger molecule with diverse functions throughout the body. NO is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission, antimicrobial and antitumoral activities. NOS2 is a nitric oxide synthase which is expressed in liver and is inducible by a combination of lipopolysaccharide and certain cytokines. iNOS has a very short half-life due to rapid degradation by calpain. iNOS monomer is a direct substrate of calpain I and can be cleaved by calpain I at the canonical CaM-binding site(503-532aa) of iNOS, and then a ~70kD band can be detected by western (PMID:11786228).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB,IHC	Mol Ther; Epsin1-mediated exosomal sorting of Dll4 modulates the tubular-macrophage crosstalk in diabetic nephropathy; Authors - Jia-Lu Liu
mouse	IF	Theranostics; Multifunctionally disordered TiO2 nanoneedles prevent periprosthetic infection and enhance osteointegration by killing bacteria and modulating the osteoimmune microenvironment; Authors - Yangmengfan Chen
mouse	IF	Proc Natl Acad Sci U S A; Sleep deficiency exacerbates periodontal inflammation via trigeminal TRPV1 neurons; Authors - Junhui Li
mouse	WB,IF	J Nanobiotechnology; Injectable photocrosslinking spherical hydrogel-encapsulated targeting peptide-modified engineered exosomes for osteoarthritis therapy; Authors - Junlai Wan
mouse	IHC	Cancer Lett; Inducible nitric oxide synthase (iNOS)-activated Cxcr2 signaling in myeloid cells promotes TGFβ-dependent squamous cell carcinoma lung metastasis; Authors - Xing Li
mouse	WB,IF	ACS Appl Mater Interfaces; Extracellular Matrix-Mimicking Hydrogel with Angiogenic and Immunomodulatory Properties Accelerates Healing of Diabetic Wounds by Promoting Autophagy; Authors - Yujie Pan