NOTCH4 Polyclonal antibody

• 

  WB analysis using 33280-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33280-1-AP (NOTCH4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse lung using 33280-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 33280-1-AP (NOTCH4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse lung using 33280-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 33280-1-AP (NOTCH4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 33280-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 33280-1-AP (NOTCH4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 33280-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 33280-1-AP (NOTCH4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 33280-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 33280-1-AP (NOTCH4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 33280-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 33280-1-AP (NOTCH4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

NOTCH4 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 33280-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

hNotch4, INT3, Notch 4, Notch 4 extracellular truncation, Notch 4 intracellular domain

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells
• Positive IHC detected in: mouse lung tissue, mouse heart tissue, mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33280-1-AP targets NOTCH4 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36738

  Product name: Recombinant human NOTCH4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 309-648 aa of BC140782

  Sequence: DCSEDVDECETQGPPHCRNGGTCQNSAGSFHCVCVSGWGGTSCEENLDDCIAATCAPGSTCIDRVGSFSCLCPPGRTGLLCHLEDMCLSQPCHGDAQCSTNPLTGSTLCLCQPGYSGPTCHQDLDECLMAQQGPSPCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECLSQPCHPGSTCLDLLATFHCLCPPGLEGQLCEVETNECASAPCLNHADCHDLLNGFQCICLPGFSGTRCEEDIDECRSSPCANGGQCQDQPGAFHCKCLPGFEGPRCQTEVDECLSDPCPVGASCLDLPGAFFCLCPSGFTGQLCEVPLCAPNLCQPKQICKDQKDKANC

• Full Name: Notch homolog 4 (Drosophila)
• Calculated Molecular Weight: 2003 aa, 210 kDa
• Observed Molecular Weight: 210 kDa
• GenBank Accession Number: BC140782
• Gene Symbol: NOTCH4
• Gene ID (NCBI): 4855
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q99466
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Neurogenic locus notch homolog protein 4 (NOTCH4) is a receptor involved in the Notch signaling pathway, which is synthesized as a precursor that undergoes proteolytic cleavage to form an active receptor. NOTCH4 interacts with various ligands, leading to the release of the Notch intracellular domain (NICD), which translocates to the nucleus and regulates gene expression (PMID: 28794168; 19379690; 17148788). NOTCH4 is involved in various biological processes, including embryonic development, immune cell differentiation, and tumorigenesis (PMID: 24667410; 34925319).