NOTUM Polyclonal antibody, PBS Only

• 

  WB analysis using 14663-1-AP (same clone as 14663-1-PBS)

  mouse liver lysates were subjected to SDS PAGE followed by western blot with 14663-1-AP (NOTUM antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14663-1-PBS in a different storage buffer formulation.

NOTUM Polyclonal Antibody for WB, Indirect ELISA

Cat No. 14663-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

14663-1-PBS targets NOTUM in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6338

  Product name: Recombinant human NOTUM protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 76-430 aa of BC060882

  Sequence: TMRRLMSSRDWPRTRTGTGILSSQPEENPYWWNANMVFIPYCSSDVWSGASSKSEKNEYAFMGALIIQEVVRELLGRGLSGAKVLLLAGSSAGGTGVLLNVDRVAEQLEKLGYPAIQVRGLADSGWFLDNKQYRHTDCVDTITCAPTEAIRRGIRYWNGVVPERCRRQFQEGEEWNCFFGYKVYPTLRCPVFVVQWLFDEAQLTVDNVHLTGQPVQEGLRLYIQNLGRELRHTLKDVPASFAPACLSHEIIIRSHWTDVQVKGTSLPRALHCWDRSLHDSHKASKTPLKGCPVHLVDSCPWPHCNPSCPTVRDQFTGQEMNVAQFLMHMGFDMQTVAQPQGLEPSELLGMLSNGS

• Full Name: notum pectinacetylesterase homolog (Drosophila)
• Calculated Molecular Weight: 56 kDa
• Observed Molecular Weight: 56 kDa
• GenBank Accession Number: BC060882
• Gene Symbol: NOTUM
• Gene ID (NCBI): 147111
• RRID: AB_2878073
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6P988
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.