NOX1 Recombinant monoclonal antibody

NOX1 Recombinant Antibody for WB, ELISA
Cat No. 84700-1-RR
Clone No.241935E7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

MOX1, MOX 1, Mitogenic oxidase 1, GP91 2, EC:1.6.3.-

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, COLO 320 cells, Caco-2 cells, mouse kidney tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84700-1-RR targets NOX1 in WB, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag12187

Product name: Recombinant human NOX1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 292-560 aa of BC075014

Sequence: QQKVVITKVVMHPSKVLELQMNKRGFSMEVGQYIFVNCPSISLLEWHPFTLTSAPEEDFFSIHIRAAGDWTENLIRAFEQQYSPIPRIEVDGPFGTASEDVFQYEVAVLVGAGIGVTPFASILKSIWYKFQCADHNLKTKKIYFYWICRETGAFSWFNNLLTSLEQEMEELGKVGFLNYRLFLTGWDSNIVGHAALNFDKATDIVTGLKQKTSFGRPMWDNEFSTIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFN

Predict reactive species
Full Name NADPH oxidase 1
Calculated Molecular Weight 564 aa, 65 kDa
Observed Molecular Weight 59 kDa
GenBank Accession NumberBC075014
Gene Symbol NOX1
Gene ID (NCBI) 27035
RRIDAB_3672116
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ9Y5S8
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NNOX1(NADPH oxidase 1) is also named as MOX1, NOH1 and belongs to the reactive oxygen species (ROS)-generating NADPH oxidase family. It plays a role in host defense, cell growth and differentiation, cell migration, and malignant transformation(PMID:20351171). It also can mediate oncogenic Ras-induced upregulation of VEGF and angiogenesis by activating Sp1 through Ras-ERK-dependent phosphorylation of Sp1(PMID:18454179). It has 3 isoforms produced by alternative splicing with the molecular weight of 65 kDa, 22 kDa and 59 kDa. The full length protein has two glycosylation sites. It always can be detected two bands of 63 kDa and 55 kDa in cells by western blot or another lower band of 45 kDa which is not likely due to alternative translation or splice variation, but as adjustment for the signal peptide and tag removal(PMID:17560373) or unspecifc(PMID:17460729).

Protocols

Product Specific Protocols
WB protocol for NOX1 antibody 84700-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...