NOX1 Recombinant monoclonal antibody, PBS Only

NOX1 Uni-rAb® Recombinant Antibody for WB, Indirect ELISA
Cat No. 84700-1-PBS
Clone No.241935E7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

MOX1, MOX 1, Mitogenic oxidase 1, GP91 2, EC:1.6.3.-

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84700-1-PBS targets NOX1 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag12187

Product name: Recombinant human NOX1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 292-560 aa of BC075014

Sequence: QQKVVITKVVMHPSKVLELQMNKRGFSMEVGQYIFVNCPSISLLEWHPFTLTSAPEEDFFSIHIRAAGDWTENLIRAFEQQYSPIPRIEVDGPFGTASEDVFQYEVAVLVGAGIGVTPFASILKSIWYKFQCADHNLKTKKIYFYWICRETGAFSWFNNLLTSLEQEMEELGKVGFLNYRLFLTGWDSNIVGHAALNFDKATDIVTGLKQKTSFGRPMWDNEFSTIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFN

Predict reactive species
Full Name NADPH oxidase 1
Calculated Molecular Weight 564 aa, 65 kDa
Observed Molecular Weight 59 kDa
GenBank Accession NumberBC075014
Gene Symbol NOX1
Gene ID (NCBI) 27035
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ9Y5S8
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

NNOX1(NADPH oxidase 1) is also named as MOX1, NOH1 and belongs to the reactive oxygen species (ROS)-generating NADPH oxidase family. It plays a role in host defense, cell growth and differentiation, cell migration, and malignant transformation(PMID:20351171). It also can mediate oncogenic Ras-induced upregulation of VEGF and angiogenesis by activating Sp1 through Ras-ERK-dependent phosphorylation of Sp1(PMID:18454179). It has 3 isoforms produced by alternative splicing with the molecular weight of 65 kDa, 22 kDa and 59 kDa. The full length protein has two glycosylation sites. It always can be detected two bands of 63 kDa and 55 kDa in cells by western blot or another lower band of 45 kDa which is not likely due to alternative translation or splice variation, but as adjustment for the signal peptide and tag removal(PMID:17560373) or unspecifc(PMID:17460729).

Loading...
||
New chat Able
正在加载,请稍候...