NOX5 Polyclonal antibody

• 

  WB analysis using 25350-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25350-1-AP (NOX5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human spleen using 25350-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 25350-1-AP (NOX5 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human spleen using 25350-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 25350-1-AP (NOX5 Antibody) at dilution of 1:200 (under 40x lens).

NOX5 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 25350-1-AP

Publications(13)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, CoIP, ELISA, PLA

Synonyms

EC:1.6.3.-, NADPH oxidase 5, NOX5A, NOX5B

---

Tested Applications

• Positive WB detected in: Jurkat cells, Raji cells
• Positive IHC detected in: human spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 13 publications below
• CoIP: See 2 publications below

Product Information

25350-1-AP targets NOX5 in WB, IHC, CoIP, ELISA, PLA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, pig, monkey
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18673

  Product name: Recombinant human NOX5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 559-719 aa of BC125098

  Sequence: YRHQKRKHTCPSCQHSWIEGVQDNMKLHKVDFIWINRDQRSFEWFVSLLTKLEMDQAEEAQYGRFLELHMYMTSALGKNDMKAIGLQMALDLLANKEKKDSITGLQTRTQPGRPDWSKVFQKVAAEKKGKVQVFFCGSPALAKVLKGHCEKFGFRFFQENF

• Full Name: NADPH oxidase, EF-hand calcium binding domain 5
• Calculated Molecular Weight: 765 aa, 86 kDa
• Observed Molecular Weight: 82-86 kDa
• GenBank Accession Number: BC125098
• Gene Symbol: NOX5
• Gene ID (NCBI): 79400
• RRID: AB_2811208
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96PH1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NOX5 (NADPH oxidase, EF-hand calcium binding domain 5) is an NADPH oxidase that generates superoxide and functions as an H+ channel in a Ca(2+)-dependent manner. It plays an important role in PDGF-induced JAK/STAT activation and human aortic smooth muscle cell (HASMC) proliferation. NOX5 is the main source of superoxide and is implicated in human spermatozoa motility. This protein has 6 isoforms produced by alternative splicing, named NOX5-α, -β, -γ, -δ, -ε and -ζ with the molecular mass of 84, 82, 86, 85, 64 and 83 kDa (PMID: 22427510 and Uniprot).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Free Radic Biol Med; Chronic hypoxia of endothelial cells boosts HIF-1α-NLRP1 circuit in Alzheimer's disease; Authors - Eunyoung Jung
monkey,human	WB	Free Radic Biol Med; Nitric oxide and heme-NO stimulate superoxide production by NADPH oxidase 5.; Authors - Elizabeth A Sweeny
human	WB,CoIP	Front Cell Dev Biol; Functional interactions between NADPH oxidase 5 and actin; Authors - Samantha M Richter
human	WB	Ecotoxicol Environ Saf; Disruption of mitochondrial redox homeostasis as a mechanism of antimony-induced reactive oxygen species and cytotoxicity.; Authors - Liling Su
human	WB,PLA,CoIP	Biomed Pharmacother; Therapeutic effect of phycocyanin on acute liver oxidative damage caused by X-ray.; Authors - Qi Liu
human	WB	Biochem Biophys Res Commun; miR-485 suppresses inflammation and proliferation of mesangial cells in an in vitro model of diabetic nephropathy by targeting NOX5.; Authors - Jian Wu