Use Able AI chat for product recommendations

NPC2 Recombinant monoclonal antibody, PBS Only

NPC2 Uni-rAb® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 86293-1-PBS
Clone No.250911E11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Indirect ELISA

He1, Human epididymis-specific protein 1, Niemann-Pick disease type C2 protein

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86293-1-PBS targets NPC2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag13719

Product name: Recombinant human NPC2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-151 aa of BC002532

Sequence: MRFLAATFLLLALSTAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHL

Predict reactive species
Full Name Niemann-Pick disease, type C2
Calculated Molecular Weight 151 aa, 17 kDa
Observed Molecular Weight17-21 kDa
GenBank Accession NumberBC002532
Gene Symbol NPC2
Gene ID (NCBI) 10577
RRIDAB_3744787
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP61916
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Niemann-Pick Type C (NPC) disease is a lysosomal storage disorder characterized by accumulation of unesterified cholesterol and other lipids in the endolysosomal system. NPC disease results from a defect in either of two distinct cholesterol-binding proteins: a transmembrane protein, NPC1, and a small soluble protein, NPC2. NPC1 or NPC2 deficiency models showed that the function of these two proteins within lysosomes are linked closely. NPC2 is also named human epididymis-specific protein 1 (HE1), defects of which are the cause of Niemann-Pick disease type C2, characterized as a lysosomal storage disorder that affects the viscera and the central nervous system. Recent finding suggests that NPC2 may serve as a novel intracrine/autocrine factor that controls adipocyte differentiation and function as well as potential therapeutic target for the treatment of type 2 diabetes and related metabolic disorders.

Loading...
||
New chat

Able

正在加载,请稍候...