NPC2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86293-1-RR (same clone as 86293-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86293-1-RR (NPC2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86293-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 86293-1-RR (same clone as 86293-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86293-1-RR (NPC2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86293-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 86293-1-RR (same clone as 86293-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using NPC2 antibody (86293-1-RR, Clone: 250911E11 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 86293-1-PBS in a different storage buffer formulation.

NPC2 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 86293-1-PBS

Clone No.250911E11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

He1, Human epididymis-specific protein 1, Niemann-Pick disease type C2 protein

---

Product Information

86293-1-PBS targets NPC2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag13719

  Product name: Recombinant human NPC2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-151 aa of BC002532

  Sequence: MRFLAATFLLLALSTAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHL

• Full Name: Niemann-Pick disease, type C2
• Calculated Molecular Weight: 151 aa, 17 kDa
• Observed Molecular Weight: 17-21 kDa
• GenBank Accession Number: BC002532
• Gene Symbol: NPC2
• Gene ID (NCBI): 10577
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P61916
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Niemann-Pick Type C (NPC) disease is a lysosomal storage disorder characterized by accumulation of unesterified cholesterol and other lipids in the endolysosomal system. NPC disease results from a defect in either of two distinct cholesterol-binding proteins: a transmembrane protein, NPC1, and a small soluble protein, NPC2. NPC1 or NPC2 deficiency models showed that the function of these two proteins within lysosomes are linked closely. NPC2 is also named human epididymis-specific protein 1 (HE1), defects of which are the cause of Niemann-Pick disease type C2, characterized as a lysosomal storage disorder that affects the viscera and the central nervous system. Recent finding suggests that NPC2 may serve as a novel intracrine/autocrine factor that controls adipocyte differentiation and function as well as potential therapeutic target for the treatment of type 2 diabetes and related metabolic disorders.