NPFFR1 Polyclonal antibody

• 

  WB analysis using 23415-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 23415-1-AP (NPFFR1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

NPFFR1 Polyclonal Antibody for WB, ELISA

Cat No. 23415-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, ELISA

Synonyms

G protein coupled receptor 147, GPR147, neuropeptide FF receptor 1, OT7T022

---

Tested Applications

• Positive WB detected in: SK-N-SH cells, PC-12 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

23415-1-AP targets NPFFR1 in WB, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20057

  Product name: Recombinant human NPFFR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 339-430 aa of BC131580

  Sequence: GFQAAFRARLCPRPSGSHKEAYSERPGGLLHRRVFVVVRPSDSGLPSESGPSSGAPRPGRLPLRNGRVAHHGLPREGPGCSHLPLTIPAWDI

• Full Name: neuropeptide FF receptor 1
• Calculated Molecular Weight: 430 aa, 48 kDa
• Observed Molecular Weight: 48-50 kDa
• GenBank Accession Number: BC131580
• Gene Symbol: NPFFR1
• Gene ID (NCBI): 64106
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q9GZQ6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NPFFR1 (Neuropeptide FF Receptor 1) is primarily focused on its role in various physiological and pathological processes. NPFFR1 is involved in modulating the effects of opioids, including their analgesic properties and side effects. This interaction has led to research into the potential use of NPFFR1 ligands to enhance opioid efficacy and reduce adverse effects (PMID: 32673481). Research suggests that NPFFR1 may have neuroprotective effects, particularly in the context of stroke recovery. It may promote neuronal survival, axonal growth, and reduce inflammation (PMID: 39519132).