NPR3 Polyclonal antibody

• 

  WB analysis of HL-60 using 25248-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 25248-1-AP (NPR3 antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 25248-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 25248-1-AP (NPR3 antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 25248-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 25248-1-AP (NPR3 antibody at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human colon cancer using 25248-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 25248-1-AP (NPR3 antibody at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human liver cancer using 25248-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 25248-1-AP (NPR3 antibody at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human liver cancer using 25248-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 25248-1-AP (NPR3 antibody at dilution of 1:50 (under 40x lens).

NPR3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 25248-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, ELISA

Synonyms

---

Published Applications

• WB: See 2 publications below

Product Information

25248-1-AP targets NPR3 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19144

  Product name: Recombinant human C5orf23 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 6-121 aa of BC022250

  Sequence: KTSHFSEEPSTCLFLNHRNGSTDPTIILHISEPMFNGGKREMHGKRTPPFLLSLKFKDVCFGMPSLLPIHRLLKSLIYSRHMCLLCPKCITFLLVMADFGCVCVRHAVNNEMKAIA

• Full Name: chromosome 5 open reading frame 23
• Calculated Molecular Weight: 541 aa, 60 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC022250
• Gene Symbol: NPR3
• Gene ID (NCBI): 79614
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cancer; Long noncoding RNA MRCCAT1 promotes metastasis of clear cell renal cell carcinoma via inhibiting NPR3 and activating p38-MAPK signaling.; Authors - Jia-Kuan Li
mouse	WB	Acta Biochim Biophys Sin (Shanghai); Skeletal muscle-derived musclin attenuates glycolysis, oxidative stress, and pulmonary hypertension through the NPR3/AKT/mTORC1 pathway; Authors - Xiongshan Sun