NPSR1 Polyclonal antibody

• 

  IHC staining of human colon cancer using 25085-1-AP

  Immunohistochemical analysis of paraffin-embedded colon cancer slide using 25085-1-AP (NPSR1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human cervical cancer using 25085-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 25085-1-AP (NPSR1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human endometrial cancer using 25085-1-AP

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer tissue slide using 25085-1-AP (NPSR1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

NPSR1 Polyclonal Antibody for IHC, ELISA

Cat No. 25085-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

neuropeptide S receptor 1, Neuropeptide S receptor, GPRA, GPR154, G protein coupled receptor 154

---

Tested Applications

• Positive IHC detected in: human colon cancer tissue, human cervical cancer tissue, human endometrial cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25085-1-AP targets NPSR1 in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18785

  Product name: Recombinant human NPSR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-52 aa of BC132693

  Sequence: MPANFTEGSFDSSGTGQTLDSSPVACTETVTFTEVVEGKEWGSFYYSFKTEQ

• Full Name: neuropeptide S receptor 1
• Calculated Molecular Weight: 371 aa, 43 kDa
• GenBank Accession Number: BC132693
• Gene Symbol: NPSR1
• Gene ID (NCBI): 387129
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6W5P4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Neuropeptide S receptor 1 (NPSR1), previously known as GPRA and GPR154, is a G protein-coupled receptor (GPCR) that plays a significant role in various physiological processes. NPSR1 is primarily expressed in the bronchus, brain, and immune cells. It is also found in specific peripheral cell types such as monocytes/macrophages and neuroendocrine cells of the gut (PMID: 30711025).