CoraLite® Plus 488-conjugated NQO1 Monoclonal antibody

NQO1 Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-67240
Clone No.1E5G7

Host / Isotype

Mouse / IgG2a

Reactivity

human, rat

Applications

IF/ICC, FC (Intra)

DT diaphorase, DIA4, DIA 4, DHQU, Azoreductase

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67240 targets NQO1 in IF/ICC, FC (Intra) applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28933

Product name: Recombinant human NQO1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-144 aa of BC007659

Sequence: MVGRRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAMYDKGPFRSKKAV

Predict reactive species
Full Name NAD(P)H dehydrogenase, quinone 1
Calculated Molecular Weight 274 aa, 31 kDa
Observed Molecular Weight 29-31 kDa
GenBank Accession NumberBC007659
Gene Symbol NQO1
Gene ID (NCBI) 1728
RRIDAB_2883401
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP15559
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

NQO1, also named as DIA4, NMOR1, DTD and QR1, belongs to the NAD(P)H dehydrogenase (quinone) family. This enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinons involved in detoxification pathways as well as in biosynthetic processes such as the vitamin K-dependent gamma-carboxylation of glutamate residues in prothrombin synthesis. It is known to be involved in benzene metabolism. In human studies of ozone exposure, polymorphisms in oxidative stress genes (NQO1, GSTM1, GSTP1) modify respiratory symptoms, lung function, biomarkers and risk of asthma. (PMID:18511640; 18848868 )

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 NQO1 antibody CL488-67240Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...