• Featured Product
  • KD/KO Validated

CAR/NR1I3 Polyclonal antibody

CAR/NR1I3 Polyclonal Antibody for WB, ELISA
Cat No. 21042-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, ELISA

CAR, Constitutive androstane receptor, NR1I3, CAR BETA, CAR1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, L02 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21042-1-AP targets CAR/NR1I3 in WB, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag15378

Product name: Recombinant human NR1I3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 7-156 aa of BC069651

Sequence: RRTVSKSIGPTCPFAGSCEVSKTQRRHCPACRLQKCLDAGMRKDMILSAEALALRRAKQAQRRAQQTPVQLSKEQEELIRTLLGAHTRHMGTMFEQFVQFRPPAHLFIHHQPLPTLAPVLPLVTHFADINTFMVLQVIKFTKDLPVFRSL

Predict reactive species
Full Name nuclear receptor subfamily 1, group I, member 3
Calculated Molecular Weight 352 aa, 40 kDa
Observed Molecular Weight 45 kDa
GenBank Accession NumberBC069651
Gene Symbol NR1I3
Gene ID (NCBI) 9970
RRIDAB_10732602
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ14994
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The nuclear hormone receptor superfamily is a large group of related transcription factors which includes members that bind a diverse array of ligands, including steroids, retinoic acid, thyroid hormone, and vitamin D. Nuclear hormone receptors contain a DNA-binding domain (DBD) and a ligand-binding domain [PMID: 10221899]. Nuclear receptor subfamily 1 group I member 3 (NR1I3; Constitutive androstane receptor: CAR), binds and transactivates the retinoic acid response elements that control expression of the retinoic acid receptor beta 2 and alcohol dehydrogenase 3 genes. It is expressed primarily in liver and regulates the expression of genes involved in xenobiotic metabolism as well as hormone, energy, and lipid homeostasis [PMID:22896671].

Protocols

Product Specific Protocols
IHC protocol for CAR/NR1I3 antibody 21042-1-APDownload protocol
WB protocol for CAR/NR1I3 antibody 21042-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Biochem Pharmacol

Constitutive androstane receptor weakens the induction of panaxytriol on CYP3A4 by repressing the activation of pregnane X receptor.

Authors - Qingqing Hu
  • KD Validated
humanWB

Front Pharmacol

Oleanolic Acid and Ursolic Acid Induce UGT1A1 Expression in HepG2 Cells by Activating PXR Rather Than CAR.

Authors - Na Yao
  • KD Validated
humanWB

Xenobiotica

A high-throughput cell-based gaussia luciferase reporter assay for measurement of CYP1A1, CYP2B6, and CYP3A4 induction.

Authors - Han Li
humanWB

J Ethnopharmacol

Panaxytriol upregulates CYP3A4 expression through the interaction between nuclear regulators and DNA response elements

Authors - Jingdi Yan
  • KD Validated
mouse,humanWB

PLoS Pathog

Lactobacillus gasseri ATCC33323 affects the intestinal mucosal barrier to ameliorate DSS-induced colitis through the NR1I3-mediated regulation of E-cadherin

Authors - Guanru Qian

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Kamal (Verified Customer) (02-15-2024)

This antibody never lets me down. Purchased again for immunohistochemistry.

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Mouse liver tissue
FH

Kamal (Verified Customer) (07-05-2023)

Worked well when diluted in TBST (1:2000) for WB and 1:200 in 1X PBS for IFC.

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1:2000 (WB) and 1:200 (IFC)
  • Cell Tissue Type: Mouse Liver tissue
FH

Zehua (Verified Customer) (11-07-2019)

It works well for immunoprecipitation!

  • Applications: Western Blot, Immunoprecipitation,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HepG2 cell
CAR/NR1I3 Antibody Western Blot,Immunoprecipitation, validation (1:1000 dilution) in HepG2 cell (Cat no:21042-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...