NR4A1 Polyclonal antibody

• 

  WB analysis using 12235-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12235-1-AP (NR4A1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 12235-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12235-1-AP (NR4A1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 12235-1-AP

  IP result of anti-NR4A1 (IP:12235-1-AP, 4ug; Detection:12235-1-AP 1:1000) with HeLa cells lysate 1720 ug.

• 

  IHC staining of mouse colon using 12235-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 12235-1-AP (NR4A1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse colon using 12235-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 12235-1-AP (NR4A1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas cancer using 12235-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 12235-1-AP (NR4A1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas cancer using 12235-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 12235-1-AP (NR4A1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of PC-3 using 12235-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed PC-3 cells using 12235-1-AP (NR4A1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

NR4A1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 12235-1-AP

Publications(41)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA

Synonyms

NGFIB, NAK1, NAK 1, N10, HMR

---

Tested Applications

• Positive WB detected in: HeLa cells, COLO 320 cells, L02 cells, mouse liver tissue, rat liver tissue, PC-3 cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: mouse colon tissue, human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 9 publications below
• WB: See 30 publications below
• IHC: See 6 publications below
• IF: See 11 publications below
• IP: See 2 publications below
• ELISA: See 1 publications below
• CoIP: See 1 publications below
• ChIP: See 5 publications below

Product Information

12235-1-AP targets NR4A1 in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2875

  Product name: Recombinant human NR4A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 300-598 aa of BC016147

  Sequence: KYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF

• Full Name: nuclear receptor subfamily 4, group A, member 1
• Calculated Molecular Weight: 598 aa, 64 kDa
• Observed Molecular Weight: 64-70 kDa
• GenBank Accession Number: BC016147
• Gene Symbol: NR4A1
• Gene ID (NCBI): 3164
• RRID: AB_10644125
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P22736
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NR4A1 is an orphan nuclear receptor that act concomitantly with NURR1 in regulating the expression of delay-early genes during liver regeneration. Also NR4A1 has linked not only to cell apoptosis but also proliferation in response to growth factor. It plays a role in caspase-independent cell death by activation of the ERK pathway and increased activity of MEF2 transcription factors. NR4A1 exists some isoforms with MW 65 and 34 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC,ChIP	Exp Mol Med; NR4A1 suppresses breast cancer growth by repressing c-Fos-mediated lipid and redox dyshomeostasis; Authors - Cen Jiang
mouse	IF	Aging (Albany NY); A systematic dissection of human primary osteoblasts in vivo at single-cell resolution.; Authors - Yun Gong
rat	WB	Sci Rep; Nur77 exacerbates PC12 cellular injury in vitro by aggravating mitochondrial impairment and endoplasmic reticulum stress.; Authors - Huimin Gao ; KD Validated
mouse	WB,IF	Sci Rep; NR4A1 Knockdown Suppresses Seizure Activity by Regulating Surface Expression of NR2B.; Authors - Yanke Zhang ; KD Validated
mouse	WB, IF	Mol Neurobiol; Contra-directional Coupling of Nur77 and Nurr1 in Neurodegeneration: A Novel Mechanism for Memantine-Induced Anti-inflammation and Anti-mitochondrial Impairment.; Authors - Xiaobo Wei
human,mouse	WB	Bioorg Chem; Structure-based design and synthesis of anti-fibrotic compounds derived from para-positioned 3,4,5-trisubstituted benzene; Authors - Wenbin Hong