NR4A1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NR4A1 Polyclonal antibody (12235-1-AP)

• Featured Product

NR4A1 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 12235-1-AP Copied!

Publications (64)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA

Synonyms

GFRP1, HMR, N10, NAK 1, NAK1

• 

  WB analysis using 12235-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12235-1-AP (NR4A1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 12235-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12235-1-AP (NR4A1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 12235-1-AP

  IP result of anti-NR4A1 (IP:12235-1-AP, 4ug; Detection:12235-1-AP 1:1000) with HeLa cells lysate 1720 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of PC-3 using 12235-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed PC-3 cells using 12235-1-AP (NR4A1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for NR4A1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, COLO 320 cells, L02 cells, mouse liver tissue, rat liver tissue, PC-3 cells
• Positive IP detected in: HeLa cells
• Positive IF/ICC detected in: PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12235-1-AP targets NR4A1 in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2875

  Product name: Recombinant human NR4A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 300-598 aa of BC016147

  Sequence: KYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF

• Full Name: nuclear receptor subfamily 4, group A, member 1
• Calculated Molecular Weight: 598 aa, 64 kDa
• Observed Molecular Weight: 64-70 kDa
• GenBank Accession Number: BC016147
• Gene Symbol: NR4A1
• Gene ID (NCBI): 3164
• RRID: AB_10644125
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P22736
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NR4A1 is an orphan nuclear receptor that act concomitantly with NURR1 in regulating the expression of delay-early genes during liver regeneration. Also NR4A1 has linked not only to cell apoptosis but also proliferation in response to growth factor. It plays a role in caspase-independent cell death by activation of the ERK pathway and increased activity of MEF2 transcription factors. NR4A1 exists some isoforms with MW 65 and 34 kDa.

Publications

What published studies show

The NR4A1 Polyclonal antibody (catalog number 12235-1-AP) has 64 citations. These appear across journals including Nature Metabolism, Experimental & Molecular Medicine, Journal of Advanced Research, Advanced Science, Cell Death & Disease, Cell Reports, Brain, Behavior, and Immunity, Journal of Biological Chemistry, and Scientific Reports. Research fields span oncology (breast, lung, liver, glioma, melanoma), liver fibrosis and metabolic disease, neurodegeneration and epilepsy, inflammation and immunity, ferroptosis, and diabetes/glucose homeostasis, with applications in WB, IF, IHC, ChIP, and CoIP.

Automatically generated from the 64 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB,ChIP	Nat Metab; HK1 from hepatic stellate cell-derived extracellular vesicles promotes progression of hepatocellular carcinoma; Authors - Qi-Tao Chen ; KO Validated
human	IHC,ChIP	Exp Mol Med; NR4A1 suppresses breast cancer growth by repressing c-Fos-mediated lipid and redox dyshomeostasis; Authors - Cen Jiang
mouse	WB,IHC,IF	J Adv Res; Nur77 attenuates Paneth cell necroptosis-induced intestinal inflammation through regulating endoplasmic reticulum homeostasis in sepsis; Authors - Chenbin Cui
mouse	WB	J Adv Res; SLC7A11 as a therapeutic target to attenuate phthalates-driven testosterone level decline in mice.; Authors - Yi Zhao
		J Nanobiotechnology; Enhancing antitumor immunity in triple-negative breast cancer through reversal of T-cell exhaustion using a CD8-targeted and membrane-camouflaged nanocarrier delivering small interfering RNA against sorting Nexin 9.; Authors - Wei Hu
		Adv Sci (Weinh); A Graphene Composite Film Based Wearable Far-Infrared Therapy Apparatus (GRAFT) for Effective Prevention of Postoperative Peritoneal Adhesion; Authors - Xiaohuan Lu