NRARP Polyclonal antibody

• 

  IHC staining of human lung cancer using 14588-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 14588-1-AP (NRARP antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 14588-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 14588-1-AP (NRARP antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A431 using 14588-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using NRARP antibody (14588-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

NRARP Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 14588-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, ELISA

Synonyms

Notch-regulated ankyrin repeat-containing protein

---

Tested Applications

• Positive IHC detected in: human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14588-1-AP targets NRARP in IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6114

  Product name: Recombinant human NRARP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-114 aa of BC053618

  Sequence: MSQAELSTCSAPQTQRIFQEAVRKGNTQELQSLLQNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDGWSALHIAAFGGHQDIVLYLITKAKYAASGR

• Full Name: NOTCH-regulated ankyrin repeat protein
• Calculated Molecular Weight: 12 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC053618
• Gene Symbol: NRARP
• Gene ID (NCBI): 441478
• RRID: AB_3085438
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7Z6K4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NRARP, Notch-regulated ankyrin repeat-containing protein, acts as a downstream effector of Notch signaling, involved in angiogenesis acting downstream of Notch at branch points to regulate vascular density. NRARP is also involved in the regulation of liver cancer cells self-renewal (PMID: 25985737, PMID: 19154719). During somitogenesis, it is involved in maintenance of proper somite segmentation and proper numbers of somites and vertebrae.