Product Information
83251-3-PBS targets NRG1, isoform Alpha in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag35114 Product name: Recombinant human NRG1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 177-241 aa of BC007675 Sequence: SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCQPGFTGARCTENVPMKVQNQEKAEELYQK Predict reactive species |
| Full Name | neuregulin 1 |
| Calculated Molecular Weight | 70 kDa |
| GenBank Accession Number | BC007675 |
| Gene Symbol | NRG1 |
| Gene ID (NCBI) | 3084 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q02297 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |

