Product Information
83251-3-PBS targets NRG1, isoform Alpha in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag35114 Product name: Recombinant human NRG1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 177-241 aa of BC007675 Sequence: SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCQPGFTGARCTENVPMKVQNQEKAEELYQK Predict reactive species |
Full Name | neuregulin 1 |
Calculated Molecular Weight | 70 kDa |
GenBank Accession Number | BC007675 |
Gene Symbol | NRG1 |
Gene ID (NCBI) | 3084 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q02297 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |