Product Information
11206-1-AP targets NRG4 in ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1697 Product name: Recombinant human NRG4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-115 aa of BC017568 Sequence: MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLFEAFVALAVLVTLIIGAFYFLCRKGHFQRASSVQYDINLVETSSTSAHHSHEQH Predict reactive species |
| Full Name | neuregulin 4 |
| Calculated Molecular Weight | 13 kDa |
| GenBank Accession Number | BC017568 |
| Gene Symbol | NRG4 |
| Gene ID (NCBI) | 145957 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8WWG1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Neuregulin 4 (Nrg4), a member of the epidermal growth factor (EGF) family of extracellular ligands, is expressed in multiple organs with the highest expression levels in brown adipose tissue. Neuregulin 4 is a secreted adipokine recently identified as playing an important role in modulating systemic energy metabolism and in the development of metabolic disorders in rodent and human obesity, including type 2 diabetes and non-alcoholic fatty liver disease (NAFLD). Nrg4 attenuates hepatic lipogenic signaling and preserves glucose and lipid homeostasis in obesity.
