Product Information
83593-2-PBS targets Neurogranin in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag0676 Product name: Recombinant human NRGN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-78 aa of BC002835 Sequence: MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGD Predict reactive species |
| Full Name | neurogranin (protein kinase C substrate, RC3) |
| Calculated Molecular Weight | 7.6 kDa |
| GenBank Accession Number | BC002835 |
| Gene Symbol | Neurogranin |
| Gene ID (NCBI) | 4900 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q92686 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
