NTAQ1/WDYHV1 Polyclonal antibody, PBS Only

• 

  WB analysis using 25308-1-AP (same clone as 25308-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 25308-1-AP (WDYHV1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25308-1-PBS in a different storage buffer formulation.

NTAQ1/WDYHV1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 25308-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

25308-1-PBS targets NTAQ1/WDYHV1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14713

  Product name: Recombinant human WDYHV1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-205 aa of BC008781

  Sequence: MEGNGPAAVHYQPASPPRDACVYSSCYCEENVWKLCEYIKNHDQYPLEECYAVFISNERKMIPIWKQQARPGDGPVIWDYHVVLLHVSSGGQSFIYDLDTVLPFPCLFDTYVEDAIKSDDDIHPQFRRKFRVICADSYLKNFASDRSHMKDSSGNWREPPPPYPCIETGDSKMNLNDFISMDPKVGWGAVYTLSEFTHRFGSKNC

• Full Name: WDYHV motif containing 1
• Calculated Molecular Weight: 205 aa, 24 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC008781
• Gene Symbol: WDYHV1
• Gene ID (NCBI): 55093
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96HA8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.