NTT4 Polyclonal antibody, PBS Only

• 

  WB analysis using 31068-1-AP (same clone as 31068-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31068-1-AP (NTT4 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31068-1-PBS in a different storage buffer formulation.

NTT4 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31068-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

31068-1-PBS targets NTT4 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34522

  Product name: Recombinant human SLC6A17 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 356-440 aa of NM_001010898

  Sequence: GFKANIMNEKCVVENAEKILGYLNTNVLSRDLIPPHVNFSHLTTKDYMEMYNVIMTVKEDQFSALGLDPCLLEDELDKSVQGTGL

• Full Name: solute carrier family 6, member 17
• Calculated Molecular Weight: 727 aa, 81 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: NM_001010898
• Gene Symbol: NTT4
• Gene ID (NCBI): 388662
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9H1V8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLC6A17 also known as NTT4, is a member of the SLC6 family of transporters, which are responsible for the presynaptic uptake of most neurotransmitters. SLC6A17 is a transporter for neutral amino acids and is exclusively expressed in the brain(PMID: 23672601). Defects in SLC6A17 cause Intellectual developmental disorder, autosomal recessive 48(PMID: 25704603). For optimal WB detection with 31068-1-AP, we do not recommend boiling the sample after lysis.