Product Information
83917-3-PBS targets NUCB2/nesfatin-1 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag25152 Product name: Recombinant human NUCB2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 25-106 aa of NM_005013 Sequence: VPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDEL Predict reactive species |
Full Name | nucleobindin 2 |
Calculated Molecular Weight | 50 kDa |
GenBank Accession Number | NM_005013 |
Gene Symbol | NUCB2 |
Gene ID (NCBI) | 4925 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P80303 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |