NUCB2/nesfatin-1 Recombinant monoclonal antibody, PBS Only

• 

NUCB2/nesfatin-1 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 83917-4-PBS

Clone No.241037E5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

NUCB2, DNA binding protein NEFA, Gastric cancer antigen Zg4, NEFA, nucleobindin 2

---

Product Information

83917-4-PBS targets NUCB2/nesfatin-1 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag25152

  Product name: Recombinant human NUCB2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 25-106 aa of NM_005013

  Sequence: VPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDEL

• Full Name: nucleobindin 2
• Calculated Molecular Weight: 50 kDa
• GenBank Accession Number: NM_005013
• Gene Symbol: NUCB2
• Gene ID (NCBI): 4925
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P80303
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.