NUDT10 Monoclonal antibody

• 

  WB analysis using 68478-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68478-1-Ig (NUDT10 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 68478-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68478-1-Ig (NUDT10 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

NUDT10 Monoclonal Antibody for WB, ELISA

Cat No. 68478-1-Ig

Clone No.3A8D5

Host / Isotype

Mouse / IgG2b

Reactivity

Human, mouse, rat

Applications

WB, ELISA

Synonyms

APS2, DIPP 3 alpha, DIPP3 alpha, DIPP3a, hAps2, hDIPP3alpha, Nudix motif 10, NUDT10

---

Tested Applications

• Positive WB detected in: U2OS cells, rat brain tissue, HEK-293 cells, rat testis tissue, mouse testis tissue, mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68478-1-Ig targets NUDT10 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11878

  Product name: Recombinant human NUDT10 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-164 aa of BC050700

  Sequence: MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGVFEQNQDPEHRTYVYVLTVTELLEDWEDSVSIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGGSPTNGNSMAPSSPDSDP

• Full Name: nudix (nucleoside diphosphate linked moiety X)-type motif 10
• Calculated Molecular Weight: 164 aa, 19 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC050700
• Gene Symbol: NUDT10
• Gene ID (NCBI): 170685
• RRID: AB_3085189
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8NFP7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NUDT10 (nucleoside diphosphate linked moiety X-type motif 10), also named as DIPP3A or APS2, belongs to the subgroup of phosphohydrolases that preferentially attack diphosphoinositol polyphosphates (PMID: 12105228, 12689335). Five human isoforms of DIPP have been found and named as DIPP type 1(NUDT3), type 2α/β(NUDT4), type 3α(NUDT10) and type 3β(NUDT11), which have the similar molecular weight and high homology (PMID: 12105228).