Tested Applications
Positive WB detected in | HeLa cells, Jurkat cells, SH-SY5Y cells |
Positive IHC detected in | human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
25381-1-AP targets NUP62CL in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag21107 Product name: Recombinant human NUP62CL protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 1-72 aa of BC017799 Sequence: MQFTSISNSLTSTAAIGLSFTTSTTTTATFTTNTTTTITSGFTVNQNQLLSRGFENLVPYTSTVRFVFYMEK Predict reactive species |
Full Name | nucleoporin 62kDa C-terminal like |
Calculated Molecular Weight | 72 aa, 8 kDa |
Observed Molecular Weight | 30 kDa |
GenBank Accession Number | BC017799 |
Gene Symbol | NUP62CL |
Gene ID (NCBI) | 54830 |
RRID | AB_2880051 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9H1M0 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for NUP62CL antibody 25381-1-AP | Download protocol |
IHC protocol for NUP62CL antibody 25381-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |