NUP85 Recombinant monoclonal antibody, PBS Only (Capture)

NUP85 Uni-rAb® Recombinant Antibody for WB, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 83288-2-PBS
Clone No.240116E10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

240116E10, 85 kDa nucleoporin, FROUNT, nucleoporin 85kDa, Nucleoporin Nup75

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83288-2-PBS targets NUP85 as part of a matched antibody pair:

MP00330-1: 83288-2-PBS capture and 83288-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag7086

Product name: Recombinant human Pericentrin protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 307-656 aa of BC000697

Sequence: FLVTRLLYSNPTVKPIDLHYYAQSSLDLFLGGESSPEPLDNILLAAFEFDIHQVIKECSIALSNWWFVAHLTDLLDHCKLLQSHNLYFGSNMREFLLLEYASGLFAHPSLWQLGVDYFDYCPELGRVSLELHIERIPLNTEQKALKVLRICEQRQMTEQVRSICKILAMKAVRNNRLGSALSWSIRAKDAAFATLVSDRFLRDYCERGCFSDLDLIDNLGPAMMLSDRLTFLGKYREFHRMYGEKRFADAASLLLSLMTSRIAPRSFWMTLLTDALPLLEQKQVIFSAEQTYELMRCLEDLTSRRPVHGESDTEQLQDDDIETTKVEMLRLSLARNLARAIIREGSLEGS

Predict reactive species
Full Name nucleoporin 85kDa
Calculated Molecular Weight 75 kDa
Observed Molecular Weight70 kDa
GenBank Accession NumberBC000697
Gene Symbol NUP85
Gene ID (NCBI) 79902
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9BW27
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Nucleoporin 85 (Nup85) (also known as FROUNT) is a protein that in humans is encoded by the NUP85 gene. This gene encodes a protein component of the Nup107-160 subunit of the nuclear pore complex. Nuclear pore complexes are embedded in the nuclear envelope and promote bidirectional transport of macromolecules between the cytoplasm and nucleus. The encoded protein can also bind to the C-terminus of chemokine (C-C motif) receptor 2 (CCR2) and promote chemotaxis of monocytes, thereby participating in the inflammatory response.

Loading...
||
New chat Able
正在加载,请稍候...