OCRL Polyclonal antibody

• 

  WB analysis of HeLa using 17695-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 17695-1-AP (OCRL antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 17695-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 17695-1-AP (OCRL antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 17695-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 17695-1-AP (OCRL Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat brain using 17695-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 17695-1-AP (OCRL Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SH-SY5Y using 17695-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 17695-1-AP (OCRL antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 17695-1-AP

  IP result of anti-OCRL (IP:17695-1-AP, 4ug; Detection:17695-1-AP 1:300) with HeLa cells lysate 1080ug.

• 

  IHC staining of mouse kidney using 17695-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 17695-1-AP (OCRL Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 17695-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 17695-1-AP (OCRL Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

OCRL Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 17695-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

INPP5F, LOCR, OCRL, OCRL1

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, mouse brain tissue, rat brain tissue, SH-SY5Y cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:100-1:400

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 5 publications below
• IHC: See 1 publications below
• IF: See 2 publications below

Product Information

17695-1-AP targets OCRL in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11900

  Product name: Recombinant human OCRL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 538-893 aa of BC094726

  Sequence: VDERRYRKVFEDSVRIMDRMENDFLPSLELSRREFVFENVKFRQLQKEKFQISNNGQVPCHFSFIPKLNDSQYCKPWLRAEPFEGYLEPNETVDISLDVYVSKDSVTILNSGEDKIEDILVLHLDRGKDYFLTISGNYLPSCFGTSLEALCRMKRPIREVPVTKLIDLEKSLLQMVPLDEGASERPLQVPKEIWLLVDHLFKYACHQEDLFQTPGMQEELQQIIDCLDTSIPETIPGSNHSVAEALLIFLEALPEPVICYELYQRCLDSAYDPRICRQVISQLPRCHRNVFRYLMAFLRELLKFSEYNSVNANMIATLFTSLLLRPPPNLMARQTPSDRQRAIQFLLGFLLGSEED

• Full Name: oculocerebrorenal syndrome of Lowe
• Calculated Molecular Weight: 893 aa, 103 kDa
• Observed Molecular Weight: 105 kDa
• GenBank Accession Number: BC094726
• Gene Symbol: OCRL
• Gene ID (NCBI): 4952
• RRID: AB_2298946
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q01968
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

OCRL is also named as INPP5F, OCRL1 and belongs to the 5-phosphatase gene family and that Lowe syndrome represents an inborn error of inositol phosphate metabolism(PMID: 9430698).The protein product of the gene that when mutated is responsible for Lowe syndrome, or oculocerebrorenal syndrome (OCRL), is an inositol polyphosphate 5-phosphatase.It may function in lysosomal membrane trafficking by regulating the specific pool of phosphatidylinositol 4,5-bisphosphate that is associated with lysosomes.It has 2 isoforms produced by alternative splicing.Defects in OCRL are the cause of Lowe oculocerebrorenal syndrome (OCRL) and Dent disease type 2 (DD2).This antibody is specific to OCRL.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	Mol Autism; Modeling the neuropsychiatric manifestations of Lowe syndrome using induced pluripotent stem cells: defective F-actin polymerization and WAVE-1 expression in neuronal cells.; Authors - Jesse Barnes ; KO Validated
human	WB	Nephrol Dial Transplant; Identification of novel OCRL isoforms associated with phenotypic differences between Dent disease-2 and Lowe syndrome.; Authors - Nana Sakakibara
human	WB	J Neurodev Disord; Transcriptome analysis of neural progenitor cells derived from Lowe syndrome induced pluripotent stem cells: identification of candidate genes for the neurodevelopmental and eye manifestations.; Authors - Hequn Liu ; KD Validated
human	IHC	BMC Med Genomics; Novel pathogenic OCRL mutations and genotype-phenotype analysis of Chinese children affected by oculocerebrorenal syndrome: two cases and a literature review; Authors - Yu Zhang
mouse	WB	Cell Death Dis; Rab35 and glucocorticoids regulate APP and BACE1 trafficking to modulate Aβ production.; Authors - Viktoriya Zhuravleva ; KD Validated
human	WB,IF	Cell Mol Life Sci; Class I PI3Ks activate stretch-induced autophagy in trabecular meshwork cells; Authors - Myoung Sup Shim