OGFOD1 Polyclonal antibody

• 

  WB analysis using 30800-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30800-1-AP (OGFOD1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon using 30800-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 30800-1-AP (OGFOD1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

OGFOD1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 30800-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

2-oxoglutarate and iron-dependent oxygenase domain-containing protein 1, EC:1.14.11.-, KIAA1612, OGFOD 1, Prolyl 3-hydroxylase OGFOD1

---

Tested Applications

• Positive WB detected in: HeLa cells, DU 145 cells
• Positive IHC detected in: human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30800-1-AP targets OGFOD1 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34034

  Product name: Recombinant human OGFOD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 193-542 aa of BC032919

  Sequence: PKQIVKSLIPSWNKLVFFEVSPVSFHQVSEVLSEEKSRLSISGWFHGPSLTRPPNYFEPPIPRSPHIPQDHEILYDWINPTYLDMDYQVQIQEEFEESSEILLKEFLKPEKFTKVCEALEHGHVEWSSRGPPNKRFYEKAEESKLPEILKECMKLFRSEALFLLLSNFTGLKLHFLAPSEEDEMNDKKEAETTDITEEGTSHSPPEPENNQMAISNNSQQSNEQTDPEPEENETKKESSVPMCQGELRHWKTGHYTLIHDHSKAEFALDLILYCGCEGWEPEYGGFTSYIAKGEDEELLTVNPESNSLALVYRDRETLKFVKHINHRSLEQKKTFPNRTGFWDFSFIYYE

• Full Name: 2-oxoglutarate and iron-dependent oxygenase domain containing 1
• Calculated Molecular Weight: 542 aa, 63 kDa
• Observed Molecular Weight: 75 kDa
• GenBank Accession Number: BC032919
• Gene Symbol: OGFOD1
• Gene ID (NCBI): 55239
• RRID: AB_3086419
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N543
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

2-oxoglutarate and iron-dependent oxygenase domain-containing protein 1 (OGFOD1) is a proly hydroxylase which belongs to 2-OG-Fe (II) dioxygenase family, it also namely KIAA1612 and TPA1. OGFOD1 is expressed in many tissues, mainly located in the nucleoplasm. It increased in many cancers and regulates both transcription and translation. The apparent molecular weight is larger than the calculated molecular weight of 63 kDa, which is likely due to posttranslational modification, presumably by glycosylation. (PMID:34298635 and 20579638)