OLIG1 Polyclonal antibody

OLIG1 Polyclonal Antibody for WB, ELISA
Cat No. 26763-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Oligo1, Class E basic helix-loop-helix protein 21, Class B basic helix-loop-helix protein 6, bHLHe21, bHLHb6

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, mouse cerebellum tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26763-1-AP targets OLIG1 in WB, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25128

Product name: Recombinant human OLIG1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-87 aa of BC026989

Sequence: MLRPQRPGDLQLGASLYELVGYRQPPSSSSSSTSSTSSTSSSSTTAPLLPKAAREKPEAPAEPPGPGPGSGAHPGGSARPDAKEEQQ

Predict reactive species
Full Name oligodendrocyte transcription factor 1
Calculated Molecular Weight 28 kDa
Observed Molecular Weight34 kDa
GenBank Accession NumberBC026989
Gene Symbol OLIG1
Gene ID (NCBI) 116448
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8TAK6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The oligodendrocyte lineage-specific basic helix-loop-helix (OLIG) family of transcription factors includes OLIG1-OLIG3, which differ in tissue expression. OLIG1 and OLIG2 are specifically expressed in nervous tissue as gene regulators of oligodendrogenesis. OLIG1 and OLIG2 interact with the Nkx-2.2 homeodomain protein, which is responsible for directing ventral neuronal patterning in response to graded Sonic hedgehog signaling in the embryonic neural tube. These interactions between OLIG proteins and Nkx-2.2 appear to promote the formation of alternate cell types by inhibiting V3 interneuron development. OLIG1 and OLIG2 are abundantly expressed in oligodendroglioma and nearly absent in astrocytomas. Therefore, OLIG proteins are candidates for molecular markers of human glial brain tumors, which are the most common primary malignancies of the human brain.

Protocols

Product Specific Protocols
IHC protocol for OLIG1 antibody 26763-1-APDownload protocol
WB protocol for OLIG1 antibody 26763-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...